Recombinant Human IP6K1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IP6K1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 182-275 of Human IHPK1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESCLDRRSEMRLKHLDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDRGYVFGLENLISIMEQMRDEN

Protein/Peptide Type
Partial Recombinant Protein
Gene
IP6K1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IP6K1 Protein

  • ATP:1D-myo-inositol-hexakisphosphate phosphotransferase
  • EC 2.7.4.21
  • inositol hexakisphosphate kinase 1
  • Inositol hexaphosphate kinase 1KIAA0263IHPK1PiUS
  • InsP6 kinase 1
  • MGC9925
  • Pi uptake stimulator

Background

IHPK1 - inositol hexaphosphate kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89635
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81711
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89693
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NB100-2383
Species: Hu
Applications: WB, ICC/IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89426
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-85407
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006575-M04
Species: Hu
Applications: WB, ELISA
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
H00009807-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IP6K1 Partial Recombinant Protein (H00009807-Q01) (0)

There are no publications for IP6K1 Partial Recombinant Protein (H00009807-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IP6K1 Partial Recombinant Protein (H00009807-Q01) (0)

There are no reviews for IP6K1 Partial Recombinant Protein (H00009807-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IP6K1 Partial Recombinant Protein (H00009807-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IP6K1 Products

Bioinformatics Tool for IP6K1 Partial Recombinant Protein (H00009807-Q01)

Discover related pathways, diseases and genes to IP6K1 Partial Recombinant Protein (H00009807-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IP6K1 Partial Recombinant Protein (H00009807-Q01)

Discover more about diseases related to IP6K1 Partial Recombinant Protein (H00009807-Q01).
 

Pathways for IP6K1 Partial Recombinant Protein (H00009807-Q01)

View related products by pathway.

PTMs for IP6K1 Partial Recombinant Protein (H00009807-Q01)

Learn more about PTMs related to IP6K1 Partial Recombinant Protein (H00009807-Q01).
 

Research Areas for IP6K1 Partial Recombinant Protein (H00009807-Q01)

Find related products by research area.

Blogs on IP6K1

There are no specific blogs for IP6K1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IP6K1 Antibody
NBP1-92026

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IP6K1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IP6K1