Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | IHPK2 (AAH65533.1, 1 a.a. - 426 a.a.) full-length human protein. MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKWNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAEDLEDLSEESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIVTEISEESGE |
Specificity | IHPK2 - inositol hexaphosphate kinase 2, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | IP6K2 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for IHPK2 Antibody (H00051447-B01P)Discover more about diseases related to IHPK2 Antibody (H00051447-B01P).
| Pathways for IHPK2 Antibody (H00051447-B01P)View related products by pathway.
|
PTMs for IHPK2 Antibody (H00051447-B01P)Learn more about PTMs related to IHPK2 Antibody (H00051447-B01P).
| Research Areas for IHPK2 Antibody (H00051447-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | IP6K2 |
Entrez |
|
Uniprot |
|