HISPPD2A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Validation of anti-PPIP5K2 and anti-PPIP5K1 antibodies specific in vitro. (A) Anti-PPIP5K2 antibody immunofluorescence signal coincides with the ...read more
Immunohistochemistry-Paraffin: HISPPD2A Antibody [NBP1-89693] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Immunocytochemistry/ Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunocytochemistry/ Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - HISPPD2A/PPIP5K1 antibody was used at 1:200 dilution for localizing PPIP5K2 protein in sensory and non-sensory cells of mouse inner ear using ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HISPPD2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPS
Specificity
Specificity of human HISPPD2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIP5K1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HISPPD2A Protein (NBP1-89693PEP)
Publications
Read Publication using
NBP1-89693 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29590114).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HISPPD2A Antibody

  • diphosphoinositol pentakisphosphate kinase 1
  • histidine acid phosphatase domain-containing protein 2A
  • inositol pyrophosphate synthase 1
  • VIP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6380
Species: Mu
Applications: WB
NBP2-38368
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92287
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89640
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-81711
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15539
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP1-89693
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for HISPPD2A Antibody (NBP1-89693)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for HISPPD2A Antibody (NBP1-89693) (0)

There are no reviews for HISPPD2A Antibody (NBP1-89693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HISPPD2A Antibody (NBP1-89693) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HISPPD2A Antibody (NBP1-89693)

Discover related pathways, diseases and genes to HISPPD2A Antibody (NBP1-89693). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HISPPD2A Antibody (NBP1-89693)

Discover more about diseases related to HISPPD2A Antibody (NBP1-89693).
 

Pathways for HISPPD2A Antibody (NBP1-89693)

View related products by pathway.

PTMs for HISPPD2A Antibody (NBP1-89693)

Learn more about PTMs related to HISPPD2A Antibody (NBP1-89693).

Blogs on HISPPD2A

There are no specific blogs for HISPPD2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HISPPD2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIP5K1