Intersectin 1 Antibody (2F12) - Azide and BSA Free

Western Blot: Intersectin 1 Antibody (2F12) [H00006453-M02-100ug] - Detection against Immunogen (35.42 KDa) .

ELISA: Intersectin 1 Antibody (2F12) [H00006453-M02-100ug] - Detection limit for recombinant GST tagged ITSN1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2F12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Intersectin 1 Antibody (2F12) - Azide and BSA Free Summary

• Immunogen: ITSN1 (NP_003015.2, 588 a.a. ~ 675 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRK
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITSN1
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Intersectin 1 Antibody (2F12) - Azide and BSA Free

• 11
• intersectin 1 (SH3 domain protein)
• intersectin short variant 12
• intersectin-1
• ITSN
• SH3 domain protein-1A
• SH3 domain-containing protein 1A
• Src homology 3 domain-containing protein

Background

Intersectin 1 is an adapter protein that may provide an indirect link between the endocytic membrane traffic and the actin assembly machinery. It may regulate the formation of clathrin-coated vesicles. Isoform 1 could be involved in brain-specific synaptic vesicle recycling. Intersectin 1 is overexpressed in brain from Down syndrome foetuses suggesting a gene dosage-dependent contribution to the abnormalities of Down syndrome. Intersectin 1 interacts with dynamin, CDC42, SNAP25 and SNAP23. It clusters several dynamin in a manner that is regulated by alternative splicing. Intersectin 1 also binds clathrin-associated proteins and other components of the endocytic machinery, such as SPIN90, EPS15, EPN1, EPN2 and STN2. Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles. Isoform 1 could be involved in brain-specific synaptic vesicle recycling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITSN1
• Entrez:
  • 6453(Human)
• OMIM:
  • 602442(Human)
• Uniprot:
  • NP_003015.2(Human)