Integrin beta 8 Antibody (2B4)

Images

 
Western Blot: Integrin beta 8 Antibody (2B4) [H00003696-M01] - Analysis of ITGB8 expression in transfected 293T cell line by ITGB8 monoclonal antibody (M01), clone 2B4.Lane 1: ITGB8 transfected lysate(85.6 KDa).Lane 2: ...read more
Immunoprecipitation: Integrin beta 8 Antibody (2B4) [H00003696-M01] - Analysis of ITGB8 transfected lysate using anti-ITGB8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ITGB8 MaxPab rabbit ...read more
ELISA: Integrin beta 8 Antibody (2B4) [H00003696-M01] - Detection limit for recombinant GST tagged ITGB8 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Flow, Func, IP
Clone
2B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Integrin beta 8 Antibody (2B4) Summary

Immunogen
ITGB8 (NP_002205, 392 a.a. ~ 503 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDE
Specificity
ITGB8 (2B4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ITGB8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Flow Cytometry
  • Functional
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00003696-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Integrin beta 8 Antibody (2B4)

  • Integrin beta 8
  • integrin beta-8
  • integrin, beta 8
  • ITGB8

Background

This gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-67573
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67635
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-90080
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
AF5269
Species: Hu, Mu
Applications: WB, IHC
NBP2-67557
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
H00003696-M01
Species: Hu
Applications: WB, ELISA, Flow, Func, IP

Publications for Integrin beta 8 Antibody (H00003696-M01)(1)

Reviews for Integrin beta 8 Antibody (H00003696-M01) (0)

There are no reviews for Integrin beta 8 Antibody (H00003696-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin beta 8 Antibody (H00003696-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Integrin beta 8 Products

Bioinformatics Tool for Integrin beta 8 Antibody (H00003696-M01)

Discover related pathways, diseases and genes to Integrin beta 8 Antibody (H00003696-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 8 Antibody (H00003696-M01)

Discover more about diseases related to Integrin beta 8 Antibody (H00003696-M01).
 

Pathways for Integrin beta 8 Antibody (H00003696-M01)

View related products by pathway.

PTMs for Integrin beta 8 Antibody (H00003696-M01)

Learn more about PTMs related to Integrin beta 8 Antibody (H00003696-M01).
 

Research Areas for Integrin beta 8 Antibody (H00003696-M01)

Find related products by research area.

Blogs on Integrin beta 8

There are no specific blogs for Integrin beta 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin beta 8 Antibody (2B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB8
Entrez
OMIM
Uniprot