Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP)

Images

 
There are currently no images for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Integrin alpha 3/CD49c Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Integrin alpha 3/CD49c.

Source: E. coli

Amino Acid Sequence: AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITGA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48514.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Integrin alpha 3/CD49c Recombinant Protein Antigen

  • antigen identified by monoclonal J143
  • CD49 antigen-like family member C
  • CD49c antigen
  • CD49c
  • FLJ34631
  • FLJ34704
  • FRP-2
  • Galactoprotein B3
  • GAP-B3
  • GAPB3CD49C
  • Integrin alpha 3
  • integrin alpha-3
  • integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
  • ITGA3
  • MSK18
  • VCA-2
  • very late activation protein 3 receptor, alpha-3 subunit
  • VL3A
  • VLA-3 subunit alpha
  • VLA3a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2405
Species: Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BBA37
Species: Hu
Applications: AdBlk
AF5676
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP) (0)

There are no publications for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP) (0)

There are no reviews for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin alpha 3/CD49c Products

Related Products by Gene

Bioinformatics Tool for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP)

Discover related pathways, diseases and genes to Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP)

Discover more about diseases related to Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP).
 

Pathways for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP)

View related products by pathway.

PTMs for Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP)

Learn more about PTMs related to Integrin alpha 3/CD49c Recombinant Protein Antigen (NBP2-48514PEP).

Blogs on Integrin alpha 3/CD49c

There are no specific blogs for Integrin alpha 3/CD49c, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Integrin alpha 3/CD49c Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA3
Entrez

Customers Who Bought This Also Bought

CD11b Antibody
NB110-89474
CD11b Antibody
NB110-89474
CD11b Antibody
NB110-89474