Integrin alpha 2/CD49b Antibody

Images

 
Orthogonal Strategies: Western Blot: Integrin alpha 2/CD49b Antibody [NBP2-38995] - Analysis in human cell lines A-431 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38995] - Staining of human liver shows no positivity in hepatocytes as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38995] - Staining of human endometrium, rectum, skin and urinary bladder using Anti-ITGA2 antibody NBP2-38995 (A) shows ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38995] - Analysis in human skin and liver tissues. Corresponding ITGA2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38995] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38995] - Staining of human endometrium shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38995] - Staining of human urinary bladder shows moderate to strong membranous positivity in urothelial cells.
Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38995] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 2/CD49b Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV
Specificity
Specificity of human Integrin alpha 2/CD49b antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 2/CD49b Antibody

  • alpha-2 subunit
  • CD49b antigen
  • CD49b
  • Integrin alpha 2
  • integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
  • ITGA2
  • VLA 2
  • VLA-2 alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-44643
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-75525
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB5376
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-83790
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6758
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NBP2-38995
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Integrin alpha 2/CD49b Antibody (NBP2-38995) (0)

There are no publications for Integrin alpha 2/CD49b Antibody (NBP2-38995).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 2/CD49b Antibody (NBP2-38995) (0)

There are no reviews for Integrin alpha 2/CD49b Antibody (NBP2-38995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 2/CD49b Antibody (NBP2-38995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Integrin alpha 2/CD49b Products

Bioinformatics Tool for Integrin alpha 2/CD49b Antibody (NBP2-38995)

Discover related pathways, diseases and genes to Integrin alpha 2/CD49b Antibody (NBP2-38995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 2/CD49b Antibody (NBP2-38995)

Discover more about diseases related to Integrin alpha 2/CD49b Antibody (NBP2-38995).
 

Pathways for Integrin alpha 2/CD49b Antibody (NBP2-38995)

View related products by pathway.

PTMs for Integrin alpha 2/CD49b Antibody (NBP2-38995)

Learn more about PTMs related to Integrin alpha 2/CD49b Antibody (NBP2-38995).
 

Research Areas for Integrin alpha 2/CD49b Antibody (NBP2-38995)

Find related products by research area.

Blogs on Integrin alpha 2/CD49b

There are no specific blogs for Integrin alpha 2/CD49b, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 2/CD49b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA2
Uniprot
COVID-19 update