Integrin alpha 2/CD49b Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38902] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38902] - Staining of human cervix, uterine shows moderate cytoplasmic positivity in basal squamous epithelial cells.

Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38902] - Staining of human endometrium, rectum, skin and urinary bladder using Anti-ITGA2 antibody NBP2-38902 (A) shows similar protein distribution across tissues to independent antibody NBP2-38995 (B).

Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38902] - Staining of human urinary bladder shows moderate to strong membranous positivity in urothelial cells.

Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38902] - Staining of human endometrium shows moderate to strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38902] - Staining of human liver shows weak membranous positivity in hepatocytes.

Immunohistochemistry-Paraffin: Integrin alpha 2/CD49b Antibody [NBP2-38902] - Staining of human skin shows moderate to strong membranous positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Integrin alpha 2/CD49b Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Integrin alpha 2/CD49b Protein (NBP2-38902PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Integrin alpha 2/CD49b Antibody - BSA Free

• alpha-2 subunit
• CD49b antigen
• CD49b
• Integrin alpha 2
• integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
• ITGA2
• VLA 2
• VLA-2 alpha

Background

Integrins are heterodimeric cell surface receptors composed of alpha and beta subunits, which mediate cell-cell and cell-extracellular matrix attachments. They are responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. Aberrant integrin expression has been found in many epithelial tumours. Changes in integrin expression have been shown to be important for the growth and early metastatic capacity of melanoma cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA2
• Uniprot:
  • P17301()