We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

INSL3 Recombinant Protein Antigen

Images

 
There are currently no images for INSL3 Protein (NBP1-81223PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

INSL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INSL3.

Source: E. coli

Amino Acid Sequence: EMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
INSL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81223.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for INSL3 Recombinant Protein Antigen

  • INSL3
  • insulin-like 3 (Leydig cell)
  • insulin-like 3
  • Ley I-L
  • leydig insulin -like hormone
  • leydig insulin -like peptide
  • Leydig insulin-like peptide
  • Ley-I-L
  • MGC119818
  • MGC119819
  • relaxin-like factor b
  • Relaxin-like factor
  • RLF
  • RLFley-I-L
  • RLNL

Background

Insulin-like 3 (INSL3), a member of the insulin-like hormone superfamily, is specifically expressed in Leydig cells of the fetal and postnatal testis and in theca cells of the postnatal ovary. It is synthesized as a 131-amino acid preproprotein, which contains a 24-amino acid signal peptide. The human INSL3 gene is assigned to bands p13.2-p12 of the short arm of chromosome 19 with the similar organization to that of insulin and relaxin. INSL3 induces gubernaculum development in an androgen-independent way, while androgen-mediated regression of the CSL occurs independently from Insl3. Moreover, INSL3 is a ligand for LGR8 and INSL3-LGR8 mutations are believed to be associated with human cryptorchidism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS4753
Species: Dr, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00059350-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, Func, ICC/IF, IHC,  IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38770
Species: Hu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
202-IL
Species: Hu
Applications: BA
AF3107
Species: Hu
Applications: IHC, WB
NBP2-93790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3204
Species: Hu, Mu, Rt
Applications: Simple Western, WB
H00005863-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NBP1-86343
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-80834
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81223PEP
Species: Hu
Applications: AC

Publications for INSL3 Protein (NBP1-81223PEP) (0)

There are no publications for INSL3 Protein (NBP1-81223PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INSL3 Protein (NBP1-81223PEP) (0)

There are no reviews for INSL3 Protein (NBP1-81223PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for INSL3 Protein (NBP1-81223PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional INSL3 Products

Research Areas for INSL3 Protein (NBP1-81223PEP)

Find related products by research area.

Blogs on INSL3

There are no specific blogs for INSL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our INSL3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol INSL3