INHBE Antibody - Azide and BSA Free

Western Blot: INHBE Antibody [H00083729-B01P] - Analysis of INHBE expression in transfected 293T cell line by INHBE polyclonal antibody. Lane 1: INHBE transfected lysate(38.61 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

INHBE Antibody - Azide and BSA Free Summary

• Immunogen: INHBE (AAH05161, 21 a.a. - 350 a.a.) full-length human protein. GTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHHLYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRGEKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
• Specificity: INHBE - inhibin, beta E,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: INHBE
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INHBE Antibody - Azide and BSA Free

• activin beta E
• Activin beta-E chain
• activin
• INHBE
• inhibin beta E chain
• Inhibin Beta E
• inhibin, beta E
• MGC4638

Background

INHBE is a member of the activin beta family (see INHBA; MIM 147290) that plays a role in pancreatic exocrine cell growth and proliferation (Hashimoto et al., 2006 [PubMed 16426570]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for INHBE Antibody (H00083729-B01P)(3)

Publications using H00083729-B01P

• Kylie A. Vestal, Chandramohan Kattamuri, Muhasin Koyiloth, Luisina Ongaro, James A. Howard, Aimee M. Deaton, Simina Ticau, Aditi Dubey, Daniel J. Bernard, Thomas B. Thompson Activin E is a transforming growth factor beta ligand that signals specifically through activin receptor-like kinase 7 Biochemical Journal 2024-04-10 [PMID: 38533769]
• Vestal K, Kattamuri C, Koyiloth M et al. Activin E is a TGF? ligand that signals specifically through activin receptor-like kinase 7 bioRxiv 2023-09-25 [PMID: 37808681] (WB, Human)
• Akbari P, Sosina OA, Bovijn J et al. Multiancestry exome sequencing reveals INHBE mutations associated with favorable fat distrWBution and protection from diabetes Nature communications 2022-08-23 [PMID: 35999217] (WB, Human)
  
  Details:
  Dilutions: 1:1000

Bioinformatics

• Gene Symbol: INHBE
• Entrez:
  • 83729(Human)
• Uniprot:
  • AAH05161.1(Human)