INCA1 Antibody


Immunohistochemistry-Paraffin: INCA1 Antibody [NBP1-90960] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

INCA1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPD
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
INCA1 Protein (NBP1-90960PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for INCA1 Antibody

  • HSD45
  • inhibitor of CDK, cyclin A1 interacting protein 1
  • MGC148150
  • MGC148151
  • protein INCA1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-WhMt
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P

Publications for INCA1 Antibody (NBP1-90960) (0)

There are no publications for INCA1 Antibody (NBP1-90960).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INCA1 Antibody (NBP1-90960) (0)

There are no reviews for INCA1 Antibody (NBP1-90960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for INCA1 Antibody (NBP1-90960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional INCA1 Products

Bioinformatics Tool for INCA1 Antibody (NBP1-90960)

Discover related pathways, diseases and genes to INCA1 Antibody (NBP1-90960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INCA1 Antibody (NBP1-90960)

Discover more about diseases related to INCA1 Antibody (NBP1-90960).

Pathways for INCA1 Antibody (NBP1-90960)

View related products by pathway.

PTMs for INCA1 Antibody (NBP1-90960)

Learn more about PTMs related to INCA1 Antibody (NBP1-90960).

Blogs on INCA1

There are no specific blogs for INCA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our INCA1 Antibody and receive a gift card or discount.


Gene Symbol INCA1