KLHDC9 Antibody

Images

 
Western Blot: KLHDC9 Antibody [NBP1-83068] - Analysis in control (vector only transfected HEK293T lysate) and KLHDC9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: KLHDC9 Antibody [NBP1-83068] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHDC9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDGRWLCVVGGWDGSRRLATVTALDTERGVWEAWTGTPGDCPPAGLSSHTCTRISDRELQVAGREGGIHTQRRYGSIYTLRLDPSARTY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHDC9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
KLHDC9 Protein (NBP1-83068PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLHDC9 Antibody

  • KARCA1Kelch/ankyrin repeat-containing cyclin A1-interacting protein
  • kelch domain containing 9
  • kelch domain-containing protein 9
  • MGC33338
  • RP11-544M22.9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00776
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-02902
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-80461
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-90960
Species: Hu
Applications: IHC, IHC-P
NBP2-14970
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38954
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KLHDC9 Antibody (NBP1-83068) (0)

There are no publications for KLHDC9 Antibody (NBP1-83068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHDC9 Antibody (NBP1-83068) (0)

There are no reviews for KLHDC9 Antibody (NBP1-83068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KLHDC9 Antibody (NBP1-83068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KLHDC9 Products

Bioinformatics Tool for KLHDC9 Antibody (NBP1-83068)

Discover related pathways, diseases and genes to KLHDC9 Antibody (NBP1-83068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHDC9 Antibody (NBP1-83068)

Discover more about diseases related to KLHDC9 Antibody (NBP1-83068).
 

Pathways for KLHDC9 Antibody (NBP1-83068)

View related products by pathway.

Blogs on KLHDC9

There are no specific blogs for KLHDC9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHDC9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHDC9