INCA Antibody - Azide and BSA Free Summary
| Immunogen |
INCA (NP_001007233.1, 1 a.a. - 110 a.a.) full-length human protein. MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS |
| Specificity |
INCA - inhibitory caspase recruitment domain (CARD) protein, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
CARD17 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for INCA Antibody - Azide and BSA Free
Background
INCA, also known as CAR17 or Caspase recruitment domain-containing protein 17, is a 110 amino acid protein that is 12 kDa; cytoplasm located; regulates procaspase-1/CASP1 activation involved in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation; and acts as an inhibitor of the release of IL1B in response to LPS in monocytes. Current research is being pursued on this protein involvement in several diseases and disorders including cancer, familial mediterranean fever, shigellosis, cowpox, neurodegenerative disease, vascular disease, mevalonic aciduria, tularemia, dermatitis, lung disease, legionnaires' disease, and arthritis. This protein has been linked to the proteolysis and regulation of apoptotic process pathways where it interacts with CASP1, CARD16, and CARD18 proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP (-), WB
Publications for INCA Antibody (H00440068-B01P) (0)
There are no publications for INCA Antibody (H00440068-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for INCA Antibody (H00440068-B01P) (0)
There are no reviews for INCA Antibody (H00440068-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for INCA Antibody (H00440068-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional INCA Products
Research Areas for INCA Antibody (H00440068-B01P)
Find related products by research area.
|
Blogs on INCA