INCA Antibody - Azide and BSA Free

Western Blot: INCA Antibody [H00440068-B01P] - Analysis of CARD17 expression in transfected 293T cell line by CARD17 polyclonal antibody. Lane 1: INCA transfected lysate(12.1 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

INCA Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse INCA Antibody - Azide and BSA Free (H00440068-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: INCA (NP_001007233.1, 1 a.a. - 110 a.a.) full-length human protein. MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS
• Specificity: INCA - inhibitory caspase recruitment domain (CARD) protein,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CARD17
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INCA Antibody - Azide and BSA Free

• caspase recruitment domain family, member 17
• caspase recruitment domain-containing protein 17
• Caspase-1 inhibitor INCA
• INCAInhibitory CARD
• inhibitory caspase recruitment domain (CARD) protein
• Inhibitory caspase recruitment domain protein

Background

INCA, also known as CAR17 or Caspase recruitment domain-containing protein 17, is a 110 amino acid protein that is 12 kDa; cytoplasm located; regulates procaspase-1/CASP1 activation involved in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation; and acts as an inhibitor of the release of IL1B in response to LPS in monocytes. Current research is being pursued on this protein involvement in several diseases and disorders including cancer, familial mediterranean fever, shigellosis, cowpox, neurodegenerative disease, vascular disease, mevalonic aciduria, tularemia, dermatitis, lung disease, legionnaires' disease, and arthritis. This protein has been linked to the proteolysis and regulation of apoptotic process pathways where it interacts with CASP1, CARD16, and CARD18 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CARD17
• Entrez:
  • 440068(Human)
• Uniprot:
  • NP_001007233.1(Human)