INCA Antibody

Images

 
Western Blot: INCA Antibody [H00440068-B01P] - Analysis of CARD17 expression in transfected 293T cell line by CARD17 polyclonal antibody. Lane 1: INCA transfected lysate(12.1 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

INCA Antibody Summary

Immunogen
INCA (NP_001007233.1, 1 a.a. - 110 a.a.) full-length human protein. MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS
Specificity
INCA - inhibitory caspase recruitment domain (CARD) protein,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CARD17
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INCA Antibody

  • caspase recruitment domain family, member 17
  • caspase recruitment domain-containing protein 17
  • Caspase-1 inhibitor INCA
  • INCAInhibitory CARD
  • inhibitory caspase recruitment domain (CARD) protein
  • Inhibitory caspase recruitment domain protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48688
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-856
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-15578
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-89705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for INCA Antibody (H00440068-B01P) (0)

There are no publications for INCA Antibody (H00440068-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INCA Antibody (H00440068-B01P) (0)

There are no reviews for INCA Antibody (H00440068-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INCA Antibody (H00440068-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INCA Products

Bioinformatics Tool for INCA Antibody (H00440068-B01P)

Discover related pathways, diseases and genes to INCA Antibody (H00440068-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for INCA Antibody (H00440068-B01P)

Find related products by research area.

Blogs on INCA

There are no specific blogs for INCA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INCA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD17
Entrez
Uniprot