Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA. The peptide sequence for this immunogen was taken from within the described region. |
| Specificity |
This product is specific to Subunit or Isoform: alpha-1. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KPNA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
60 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free
Background
Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. KPNA1 interacts with RAG1 and may play a role in V(D)J recombination.Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Mu
Applications: ChIP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Publications for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54603) (0)
There are no publications for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54603).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54603) (0)
There are no reviews for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54603).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Importin alpha 5/KPNA1/SRP1 Antibody (NBP1-54603) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Importin alpha 5/KPNA1/SRP1 Products
Blogs on Importin alpha 5/KPNA1/SRP1