Importin alpha 3/KPNA4 Antibody - BSA Free

Western Blot: Importin alpha 3/KPNA4 Antibody [NBP2-38541] - Analysis using Anti-KPNA4 antibody NBP2-38541 (A) shows similar pattern to independent antibody NBP2-14173 (B).

Immunocytochemistry/Immunofluorescence: Importin alpha 3/KPNA4 Antibody [NBP2-38541] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear membrane.

Immunohistochemistry-Paraffin: Importin alpha 3/KPNA4 Antibody [NBP2-38541] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Importin alpha 3/KPNA4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KPNA4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Importin alpha 3/KPNA4 Protein (NBP2-38541PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Importin alpha 3/KPNA4 Antibody - BSA Free

• Importin alpha 3
• Importin alpha Q1
• importin subunit alpha-4
• importin-alpha-Q1
• IPOA3
• karyopherin alpha 4 (importin alpha 3)
• KPNA4
• MGC12217
• MGC26703
• Qip1
• QIP12
• QIP1Karyopherin subunit alpha-4
• SRP3

Background

The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. The protein encoded by this gene shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KPNA4
• Uniprot:
  • O00629()