Importin alpha 2/KPNA2 Antibody - BSA Free

Western Blot: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunocytochemistry/Immunofluorescence: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Staining in human testis and pancreas tissues using anti-KPNA2 antibody. Corresponding KPNA2 RNA-seq data are presented for the same tissues.

Immunohistochemistry: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Immunohistochemistry-Paraffin: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Staining of human testis shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Importin alpha 2/KPNA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KPNA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Importin alpha 2/KPNA2 Protein (NBP2-38482PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Importin alpha 2/KPNA2 Antibody - BSA Free

• Importin alpha 1
• Importin alpha 2
• importin-alpha-P1
• IPOA1
• karyopherin alpha 2 (RAG cohort 1, importin alpha 1)
• Karyopherin subunit alpha-2
• KPNA2
• Pendulin
• QIP2
• QIP2importin alpha 2
• RAG cohort 1
• RAG cohort protein 1
• RCH1
• RCH1importin subunit alpha-2
• SRP1
• SRP1alpha
• SRP1-alpha

Background

The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KPNA2
• Uniprot:
  • P52292(Human)