We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Importin alpha 2/KPNA2 Antibody - BSA Free

Images

 
Western Blot: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Orthogonal Strategies: Immunohistochemistry-Paraffin: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Staining in human testis and pancreas tissues using anti-KPNA2 antibody. Corresponding KPNA2 RNA-seq data are ...read more
Immunohistochemistry: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Importin alpha 2/KPNA2 Antibody [NBP2-38482] - Staining of human testis shows high expression.
Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Importin alpha 2/KPNA2 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLL
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KPNA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Importin alpha 2/KPNA2 Protein (NBP2-38482PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Importin alpha 2/KPNA2 Antibody - BSA Free

  • Importin alpha 1
  • Importin alpha 2
  • importin-alpha-P1
  • IPOA1
  • karyopherin alpha 2 (RAG cohort 1, importin alpha 1)
  • Karyopherin subunit alpha-2
  • KPNA2
  • Pendulin
  • QIP2
  • QIP2importin alpha 2
  • RAG cohort 1
  • RAG cohort protein 1
  • RCH1
  • RCH1importin subunit alpha-2
  • SRP1
  • SRP1alpha
  • SRP1-alpha

Background

The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003836-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-31260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-74190
Species: Mu
Applications: ChIP, WB
NB100-81650
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-87712
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-86960
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-43666
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85638
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-47281
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-16694
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
NBP1-31209
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KO, WB
NBP2-38482
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Importin alpha 2/KPNA2 Antibody (NBP2-38482) (0)

There are no publications for Importin alpha 2/KPNA2 Antibody (NBP2-38482).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin alpha 2/KPNA2 Antibody (NBP2-38482) (0)

There are no reviews for Importin alpha 2/KPNA2 Antibody (NBP2-38482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Importin alpha 2/KPNA2 Antibody (NBP2-38482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Importin alpha 2/KPNA2 Products

Research Areas for Importin alpha 2/KPNA2 Antibody (NBP2-38482)

Find related products by research area.

Blogs on Importin alpha 2/KPNA2

There are no specific blogs for Importin alpha 2/KPNA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Importin alpha 2/KPNA2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol KPNA2
Uniprot