GMEB1 Antibody (2A8)

Images

 
Western Blot: GMEB1 Antibody (2A8) [H00010691-M01] - GMEB1 monoclonal antibody (M01), clone 2A8 Analysis of GMEB1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: GMEB1 Antibody (2A8) [H00010691-M01] - Analysis of monoclonal antibody to GMEB1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: GMEB1 Antibody (2A8) [H00010691-M01] - Analysis of monoclonal antibody to GMEB1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: GMEB1 Antibody (2A8) [H00010691-M01] - Detection limit for recombinant GST tagged GMEB1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
2A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GMEB1 Antibody (2A8) Summary

Immunogen
GMEB1 (NP_077808, 467 a.a. ~ 563 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQHQVHNVEIVVLED
Localization
Nucleus. Cytoplasm. Note=May be also cytoplasmic.
Specificity
GMEB1 - glucocorticoid modulatory element binding protein 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GMEB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GMEB1 Antibody (2A8)

  • DNA-binding protein p96PIF
  • glucocorticoid modulatory element binding protein 1
  • glucocorticoid modulatory element-binding protein 1
  • GMEB-1
  • P96PIF
  • Parvovirus initiation factor p96
  • PIF p96
  • PIF96

Background

This gene is a member of KDWK gene family. The product of this gene associates with GMEB2 protein, and the complex is essential for parvovirus DNA replication. Study of rat homolog implicates the role of this gene in modulation of transactivation by the glucocorticoid receptor bound to glucocorticoid response elements. Two alternative spliced transcript variants encoding different isoforms exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81421
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-79807
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47281
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-79286
Species: Rt
Applications: WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00010691-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC

Publications for GMEB1 Antibody (H00010691-M01) (0)

There are no publications for GMEB1 Antibody (H00010691-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMEB1 Antibody (H00010691-M01) (0)

There are no reviews for GMEB1 Antibody (H00010691-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GMEB1 Antibody (H00010691-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GMEB1 Products

Diseases for GMEB1 Antibody (H00010691-M01)

Discover more about diseases related to GMEB1 Antibody (H00010691-M01).
 

Pathways for GMEB1 Antibody (H00010691-M01)

View related products by pathway.

PTMs for GMEB1 Antibody (H00010691-M01)

Learn more about PTMs related to GMEB1 Antibody (H00010691-M01).

Blogs on GMEB1

There are no specific blogs for GMEB1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMEB1 Antibody (2A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol GMEB1
Entrez
OMIM
Uniprot