Importin-9 Antibody - BSA Free

Western Blot: Importin-9 Antibody [NBP2-86679] - Host: Rabbit. Target Name: IPO9. Sample Tissue: Human Leiomyosarcoma Tumor lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Importin-9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Importin-9 Antibody - BSA Free (NBP2-86679) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human Importin-9. Peptide sequence: ARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYEEDY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IPO9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Importin-9 Antibody - BSA Free

• DKFZp761M1547
• FLJ10402
• Imp9IMP9
• importin 9
• importin-9
• KIAA1192
• Ran-binding protein 9
• ranBP9

Background

Official Gene Symbol: IPO9 Gene ID: 55705 (Human) Gene Map Locus: 1q32.1 (Human) Importin 9 is a novel member of highly conserved Karyopherin Super family. Karyopherins are transport receptors consisting of an N-terminal RanGTP-binding motif and mediate the transport of protein and RNA across the nucleus and cytoplasm. These proteins interact directly with nuclear pore complex and shuttle continuously between the nucleus and cytoplasm. Importin-9 is a RAN-GTP binding protein and mediates the nuclear import of individual core histones and TBP. Reports suggest Importin-9 also interacts with subunits of PP2A (protein phosphatase 2A) and aids in nuclear import.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IPO9