Importin-7 Antibody

Images

 
Western Blot: Importin-7 Antibody [NBP1-87880] - Analysis in human cell line RH-30.
Immunohistochemistry-Paraffin: Importin-7 Antibody [NBP1-87880] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western Blot: Importin-7 Antibody [NBP1-87880] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Importin-7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IPO7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Importin-7 Protein (NBP1-87880PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Importin-7 Antibody

  • FLJ14581
  • Imp7MGC138673
  • importin 7
  • RAN binding protein 7
  • Ran-binding protein 7
  • RanBP7
  • RANBP7importin-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-24751
Species: Hu, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003843-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP1-92626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
355-BM/CF
Species: Hu, Mu, Rt
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB400-151
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA

Publications for Importin-7 Antibody (NBP1-87880) (0)

There are no publications for Importin-7 Antibody (NBP1-87880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin-7 Antibody (NBP1-87880) (0)

There are no reviews for Importin-7 Antibody (NBP1-87880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin-7 Antibody (NBP1-87880). (Showing 1 - 1 of 1 FAQ).

  1. I have noticed that you have a rabbit polyclonal anti-human Ipo7. I am searching for a primary mouse/goat ab anti-human Importin7 (Ipo7) that is suitable for IF, WB application. Could you please tell me if you have something that is suitable for me?
    • NBP1-87880 suits all of your needs but is a rabbit host. I am not sure if this will work for you or not. NB100-1081 is our only goat host antibody and it has been validated in Western blot and ELISA. It is expected to work in ICC though, since it is known to recognize the protein in its native form. Please let me know if you have further questions or need further clarification.

Secondary Antibodies

 

Isotype Controls

Additional Importin-7 Products

Bioinformatics Tool for Importin-7 Antibody (NBP1-87880)

Discover related pathways, diseases and genes to Importin-7 Antibody (NBP1-87880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin-7 Antibody (NBP1-87880)

Discover more about diseases related to Importin-7 Antibody (NBP1-87880).
 

Pathways for Importin-7 Antibody (NBP1-87880)

View related products by pathway.

PTMs for Importin-7 Antibody (NBP1-87880)

Learn more about PTMs related to Importin-7 Antibody (NBP1-87880).

Blogs on Importin-7

There are no specific blogs for Importin-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Importin-7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO7