Recombinant Human Importin-13 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Importin-13 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-963 of Human IPO13 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MERREEQPGAAGAGAAPALDFTVENVEKALHQLYYDPNIENKNLAQKWLMQAQVSPQAWHFSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSKIVLTRLCVALASLALSMMPDAWPCAVADMVRLFQAEDSPVDGQGRCLALLELLTVLPEEFQTSRLPQYRKGLVRTSLAVECGAVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEVPLQDCEALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNGDMETSHGICRIAVALGENHSRALLDQVEHWQSFLALVNMIMFCTGIPGHYPVNETTSSLTLTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVLLHKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSEEPYSWQHTEALLYGFQSIAETIDVNYSDVVPGLIGLIPRISISNVQLADTVMFTIGALSEWLADHPVMINSVLPLVLHALGNPELSVSSVSTLKKICRECKYDLPPYAANIVAVSQDVLMKQIHKTSQCMWLMQALGFLLSALQVEEILKNLHSLISPYIQQLEKLAEEIPNPSNKLAIVHILGLLSNLFTTLDISHHEDDHEGPELRKLPVPQGPNPVVVVLQQVFQLIQKVLSKWLNDAQVVEAVCAIFEKSVKTLLDDFAPMVPQLCEMLGRMYSTIPQASALDLTRQLVHIFAHEPAHFPPIEALFLLVTSVTLTLFQQGPRDHPDIVDSFMQLLAQALKRKPDLFLCERLDVKSVFQCAVLALKFPEAPTVKASCGFFTELLPRCGEVESVGKVVQEDGRMLLIAVLEAIGGQASRSLMDCFADILFALNKHCFSLLSMWIKEALQPPGFPSARLSPEQKDTFSQQILRERVNKRRVKEMVKEFTLLCRGLHGTDYTADY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
IPO13
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Importin-13 Protein

  • IMP13
  • importin 13
  • importin-13
  • KAP13
  • karyopherin 13
  • Karyopherin-13
  • KIAA0724karyopherin-13
  • LGL2
  • Ran binding protein 13
  • Ran-binding protein 13
  • RanBP13
  • RANBP13late gestation lung 2

Background

IPO13 is a member of the importin-beta superfamily (see MIM 602738). Importins mediate translocation through nuclear pore complexes. Cooperation with the RanGTPase system allows them to bind and subsequently release their substrates on opposite sides of the nuclear envelope ensuring direct nucleocytoplasmic transport (Mingot et al., 2001 [PubMed 11447110]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56176
Species: Hu
Applications: ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-91288
Species: Mu
Applications: IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for Importin-13 Recombinant Protein (H00009670-P01) (0)

There are no publications for Importin-13 Recombinant Protein (H00009670-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin-13 Recombinant Protein (H00009670-P01) (0)

There are no reviews for Importin-13 Recombinant Protein (H00009670-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Importin-13 Recombinant Protein (H00009670-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Importin-13 Products

Bioinformatics Tool for Importin-13 Recombinant Protein (H00009670-P01)

Discover related pathways, diseases and genes to Importin-13 Recombinant Protein (H00009670-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin-13 Recombinant Protein (H00009670-P01)

Discover more about diseases related to Importin-13 Recombinant Protein (H00009670-P01).
 

Pathways for Importin-13 Recombinant Protein (H00009670-P01)

View related products by pathway.

Blogs on Importin-13

There are no specific blogs for Importin-13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Importin-13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO13