Home » IMPACT » IMPACT Antibodies » IMPACT Antibody

IMPACT Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: IMPACT Antibody [NBP1-86221] - IMPACT overexpression confers GL261 glioma cells increased survival during tryptophan deprivation. Western blotting with indicated antibodies on GL261-wild-type and GL261-IMPACThigh lines cultured in standard media containing 50 uM tryptophan over a period of 8 days. Doubling time is shown as a mean +/- SD. Image collected and cropped by CiteAb from the following publication (//biosignaling.biomedcentral.com/articles/10.1186/s12964-018-0301-7), licensed under a CC-BY licence.
Western Blot: IMPACT Antibody [NBP1-86221] - IMPACT overexpression confers GL261 glioma cells increased survival during tryptophan deprivation. Western blotting with indicated antibodies on GL261-wild-type and ...read more
Immunocytochemistry/ Immunofluorescence: IMPACT Antibody [NBP1-86221] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Western Blot: IMPACT Antibody [NBP1-86221] - Analysis in control (vector only transfected HEK293T lysate) and IMPACT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

IMPACT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVV
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPACT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IMPACT Protein (NBP1-86221PEP)
Publications
Read Publication using
NBP1-86221 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30466445).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IMPACT Antibody

  • Impact homolog (mouse)
  • Imprinted and ancient gene protein homolog
  • MGC33718
  • protein IMPACT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GCN2 Antibody
(JA03-83)
NBP2-66865
Flow Cytometry: GCN2 Antibody (JA03-83) [NBP2-66865] - Analysis of MCF-7 cells with GCN2 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: GCN2 Antibody (JA03-83) [NBP2-66865] - Staining GCN2 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: GCN2 Antibody (JA03-83) [NBP2-66865] - Staining GCN2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ATF4 Antibody
(SD20-92)
NBP2-67766
Flow Cytometry: ATF4 Antibody (SD20-92) [NBP2-67766] - Analysis of Hela cells with ATF4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ATF4 Antibody (SD20-92) [NBP2-67766] - Staining ATF4 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Western Blot: ATF4 Antibody (SD20-92) [NBP2-67766] - Analysis of ATF4 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: HeLa cell lysateLane 2: PC-12 cell lysate Lane 3: HL-60 cell lysate Lane 4: K562 cell lysateLane 5: human lung carcinoma tissue lysate.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
Flow Cytometry: GADD153/CHOP Antibody (9C8) [NB600-1335] - An intracellular stain was performed on SK-MEL-28 cells with GADD153/CHOP Antibody (9C8) NB600-1335 (blue) and a matched isotype control MAB004 (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (84540, Thermo Fisher).
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody (9C8) [NB600-1335] - FFPE tissue section of mouse brain using 1:100 dilution of GADD153/CHOP antibody. The signal was developed using HRP-DAB based detection method which followed counterstaining of the nuclei with hematoxylin. The antibody generated a cytoplasmic and nuclear staining of CHOP in various cell types in the tested section.
(3 Reviews)
(37 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
GCN1L1 Antibody
NBP1-83382
Immunocytochemistry/Immunofluorescence: GCN1L1 Antibody [NBP1-83382] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GCN1L1 Antibody [NBP1-83382] - Staining of human testis shows high expression.
Western Blot: GCN1L1 Antibody [NBP1-83382] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-GCN1 antibody. Remaining relative intensity is presented.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MEST Antibody
NBP1-87299
Western Blot: MEST Antibody [NBP1-87299] - Analysis in control (vector only transfected HEK293T lysate) and MEST over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419353).
Immunocytochemistry/Immunofluorescence: MEST Antibody [NBP1-87299] - Immunofluorescent staining of human cell line A-431 shows positivity in golgi apparatus. Antibody staining in green.
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
ATF2 [p Thr69]
Antibody
NB100-81798
Western Blot: ATF2 [p Thr69] Antibody [NB100-81798] - Human U251 glioma cell line, whole cell lysates. Cells have been treated with JNK and p38 inhibitors. WB image submitted by a verified customer review.
Immunohistochemistry: ATF2 [p Thr69] Antibody [NB100-81798] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue using ATF-2 (phospho-Thr69 or 51) antibody NB100-81798.
Western Blot: ATF2 [p Thr69] Antibody [NB100-81798] - Analysis of extracts from 3T3 cells untreated or treated with Anisomycin using ATF2 (Phospho-Thr69 or 51) antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p57 Kip2 Antibody
NBP1-89917
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: p57 Kip2 Antibody [NBP1-89917] - Staining in human placenta and colon tissues using anti-CDKN1C antibody. Corresponding CDKN1C RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Indoleamine
2,3-dioxygenase/IDO A ...
NBP1-87702
Western Blot: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Staining in human placenta and cerebral cortex tissues . Corresponding IDO1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in non-germinal center cells.
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
WDR20 Antibody
NB100-86989
Immunohistochemistry-Paraffin: WDR20 Antibody [NB100-86989] - FFPE section of human small cell lung cancer. Antibody: Affinity purified rabbit anti-WDR20 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: WDR20 Antibody [NB100-86989] - Detection of Human and Mouse WDR20 by Western Blot (h&m) and Immunoprecipitation (h). Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-WDR20 antibody NB100-86989 used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate. WDR20 was also immunoprecipitated by another rabbit anti-WDR20 antibody which recognizes an upstream epitope.
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
PLAGL1 Antibody
(8D8C5) - BSA Free
NBP2-37343
ELISA: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Western blot analysis using PLAGL1 mAb against human PLAGL1 recombinant protein. (Expected MW is 37.5 kDa)
Western Blot: PLAGL1 Antibody (8D8C5) [NBP2-37343] - Western blot analysis using PLAGL1 mAb against HEK293 (1) and PLAGL1 (AA: 118-222)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
SNRPN Antibody
NBP2-20439
Immunohistochemistry-Paraffin: SNRPN Antibody [NBP2-20439] - SNRPN antibody detects SNRPN protein at cytosol on mouse kidney by immunohistochemical analysis. Sample: Paraffin-embedded mouse kidney. SNRPN antibody dilution: 1:500.
Immunohistochemistry-Paraffin: SNRPN Antibody [NBP2-20439] - SNRPN antibody detects SNRPN protein at cytosol on rat fore brain by immunohistochemical analysis. Sample: Paraffin-embedded rat fore brain. SNRPN antibody dilution: 1:500.
Western Blot: SNRPN Antibody [NBP2-20439] - Sample (30 ug of whole cell lysate) A: JurKat 12% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
IGF-II R/IGF2R
Antibody (2G11) - BSA ...
NB300-514
Flow Cytometry: IGF-II R/IGF2R Antibody (2G11) [NB300-514] - An intracellular stain was performed on MCF7 cells with IGF-II R/IGF2R [2G11] Antibody NB300-514AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: IGF-II R/IGF2R Antibody (2G11) [NB300-514] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-IGF-II R/IGF2R Antibody (2G11) NB300-514 at 1 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: Mannose 6 Phosphate Receptor (Cation independent) Antibody (2G11) [NB300-514] - Mannose 6-Phosphate Receptor staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Mannose 6-Phosphate Receptor at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(10 Publications)
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
MKRN3 Antibody -
BSA Free
NBP2-81964
Western Blot: MKRN3 Antibody [NBP2-81964] - Analysis of MKRN3 in human spleen tissue lysate with MKRN3 antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: MKRN3 Antibody [NBP2-81964] - Analysis of MKRN3 in human spleen tissue with MKRN3 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
GRB10 Antibody
NB100-88153
Immunohistochemistry: GRB10 Antibody [NB100-88153] - Sample: FFPE section of human colon carcinoma. Antibody: Affinity purified rabbit anti-GRB10 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: GRB10 Antibody [NB100-88153] - FFPE section of human ovarian carcinoma. Affinity purified rabbit anti-GRB10 used at a dilution of 1:250
Immunoprecipitation: GRB10 Antibody [NB100-88153] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. NB100-88153 used for IP at 3 mcg/mg lysate. GRB10 was also immunoprecipitated by rabbit anti- GRB10 antibody NB100-88152, which recognizes an upstream epitope.
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Rpn2 Antibody
NBP2-38323
Immunocytochemistry/Immunofluorescence: Rpn2 Antibody [NBP2-38323] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments.
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human cerebral cortex, kidney, liver and testis using Anti-PSMD1 antibody NBP2-38323 (A) shows similar protein distribution across tissues to independent antibody NBP2-38324 (B).
Immunohistochemistry-Paraffin: Rpn2 Antibody [NBP2-38323] - Staining of human testis.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(3 Publications)
Species: Hu
Applications: BA
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human liver cancer tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human skin tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SPG7 Antibody
(OTI1C1)
NBP2-01860
Western Blot: SPG7 Antibody (OTI1C1) [NBP2-01860] - Loss of AFG3L2 and/or YME1L is associated with elevated OMA1, diminished SPG7, and a markedly altered pattern of OPA1 protein forms. Whole-cell lysates were resolved using SDS-PAGE and western blotted with antibody to Drp1, Oma1, and Spg7. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/19/12/3930), licensed under a CC-BY licence.
Flow Cytometry: SPG7 Antibody (OTI1C1) [NBP2-01860] - Analysis of Hela cells, using anti-SPG7 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: SPG7 Antibody (OTI1C1) [NBP2-01860] - Analysis of Jurkat cells, using anti-SPG7 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(1 Review)
(3 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
OSBP1 Antibody
(OTI1F2)
NBP2-00935
Flow Cytometry: OSBP1 Antibody (1F2) [NBP2-00935] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-OSBP1 antibody, and then analyzed by flow cytometry.
Western Blot: OSBP1 Antibody (1F2) [NBP2-00935] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY OSBP1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-OSBP1.
Immunohistochemistry-Paraffin: OSBP1 Antibody (1F2) [NBP2-00935] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-OSBP1 mouse monoclonal antibody.
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IMPACT Antibody
NBP1-86221
IMPACT Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IMPACT Antibody (NBP1-86221)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for IMPACT Antibody (NBP1-86221) (0)

There are no reviews for IMPACT Antibody (NBP1-86221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IMPACT Antibody (NBP1-86221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IMPACT Products

Bioinformatics Tool for IMPACT Antibody (NBP1-86221)

Discover related pathways, diseases and genes to IMPACT Antibody (NBP1-86221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMPACT Antibody (NBP1-86221)

Discover more about diseases related to IMPACT Antibody (NBP1-86221).
 

Pathways for IMPACT Antibody (NBP1-86221)

View related products by pathway.

PTMs for IMPACT Antibody (NBP1-86221)

Learn more about PTMs related to IMPACT Antibody (NBP1-86221).
 

Research Areas for IMPACT Antibody (NBP1-86221)

Find related products by research area.

Blogs on IMPACT

There are no specific blogs for IMPACT, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMPACT Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IMPACT