IMPACT Antibody

Images

 
Western Blot: IMPACT Antibody [NBP1-86221] - IMPACT overexpression confers GL261 glioma cells increased survival during tryptophan deprivation. Western blotting with indicated antibodies on GL261-wild-type and ...read more
Immunocytochemistry/ Immunofluorescence: IMPACT Antibody [NBP1-86221] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Western Blot: IMPACT Antibody [NBP1-86221] - Analysis in control (vector only transfected HEK293T lysate) and IMPACT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IMPACT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVV
Specificity
Specificity of human IMPACT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPACT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IMPACT Protein (NBP1-86221PEP)
Publications
Read Publication using
NBP1-86221 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30466445).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IMPACT Antibody

  • Impact homolog (mouse)
  • Imprinted and ancient gene protein homolog
  • MGC33718
  • protein IMPACT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-852
Species: Hu, Mu
Applications: WB, PEP-ELISA
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP, KD
NBP1-83382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-87299
Species: Hu
Applications: WB, ICC/IF
NBP2-67573
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-86989
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-37343
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-81964
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-88153
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP2-00935
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86221
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IMPACT Antibody (NBP1-86221)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for IMPACT Antibody (NBP1-86221) (0)

There are no reviews for IMPACT Antibody (NBP1-86221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IMPACT Antibody (NBP1-86221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IMPACT Products

Bioinformatics Tool for IMPACT Antibody (NBP1-86221)

Discover related pathways, diseases and genes to IMPACT Antibody (NBP1-86221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMPACT Antibody (NBP1-86221)

Discover more about diseases related to IMPACT Antibody (NBP1-86221).
 

Pathways for IMPACT Antibody (NBP1-86221)

View related products by pathway.

PTMs for IMPACT Antibody (NBP1-86221)

Learn more about PTMs related to IMPACT Antibody (NBP1-86221).

Blogs on IMPACT

There are no specific blogs for IMPACT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMPACT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPACT