IMPACT Antibody - BSA Free

IMPACT-Antibody-Western-Blot-NBP1-86221-img0012.jpg

Immunocytochemistry/Immunofluorescence: IMPACT Antibody [NBP1-86221] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: IMPACT Antibody [NBP1-86221] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and IMPACT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IMPACT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVV
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IMPACT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IMPACT Protein (NBP1-86221PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30466445).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IMPACT Antibody - BSA Free

• Impact homolog (mouse)
• Imprinted and ancient gene protein homolog
• MGC33718
• protein IMPACT

Background

Translational regulator that ensures constant high levels of translation under amino acid starvation. Acts by interacting with GCN1/GCN1L1, thereby preventing activation of GCN2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IMPACT Antibody (NBP1-86221)(1)

Publication using NBP1-86221

• Tomek P, Gore SK, Potts CL et al. Imprinted and ancient gene: a potential mediator of cancer cell survival during tryptophan deprivation. Cell Commun. Signal. 2018-11-22 [PMID: 30466445] (WB, Mouse)

Bioinformatics

• Gene Symbol: IMPACT