We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

IMP2/IGF2BP2 Recombinant Protein Antigen

Images

 
There are currently no images for IMP2/IGF2BP2 Protein (NBP2-33992PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IMP2/IGF2BP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGF2BP2.

Source: E. coli

Amino Acid Sequence: ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IGF2BP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33992.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IMP2/IGF2BP2 Recombinant Protein Antigen

  • Hepatocellular carcinoma autoantigen p62
  • IF2B2
  • IGF2BP2
  • IGF-II mRNA-binding protein 2
  • IMP2
  • IMP-2IGF2 mRNA-binding protein 2
  • IMP2VICKZ family member 2
  • insulin-like growth factor 2 mRNA binding protein 2
  • insulin-like growth factor 2 mRNA-binding protein 2
  • p62
  • VICKZ2

Background

IGF2BP2 encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains several four KH domains and two RRM domains. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, Simple Western, SB, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NB100-82112
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
MAB7936
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32796
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-87539
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38956
Species: Hu
Applications: ChIP, IHC,  IHC-P, Simple Western, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
H00003087-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-92389
Species: Hu
Applications: IHC,  IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB

Publications for IMP2/IGF2BP2 Protein (NBP2-33992PEP) (0)

There are no publications for IMP2/IGF2BP2 Protein (NBP2-33992PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMP2/IGF2BP2 Protein (NBP2-33992PEP) (0)

There are no reviews for IMP2/IGF2BP2 Protein (NBP2-33992PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IMP2/IGF2BP2 Protein (NBP2-33992PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IMP2/IGF2BP2 Products

Research Areas for IMP2/IGF2BP2 Protein (NBP2-33992PEP)

Find related products by research area.

Blogs on IMP2/IGF2BP2

There are no specific blogs for IMP2/IGF2BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IMP2/IGF2BP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2BP2