IL25 Antibody


Immunohistochemistry: IL25 Antibody [NBP2-48750] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

IL25 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSY
Specificity of human IL25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL25 Recombinant Protein Antigen (NBP2-48750PEP)

Reactivity Notes

Highest antigen sequence identity to the following ortholog: Rat ENSRNOG00000046883 (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IL25 Antibody

  • C19orf10
  • chromosome 19 open reading frame 10
  • EUROIMAGE1875335
  • IL-25
  • IL25IL27w
  • IL27
  • IL-27
  • interleukin 25
  • interleukin 27 working designation
  • Interleukin-25
  • Ly6elg
  • R33729_1
  • SF20
  • SF20hypothetical protein LOC56005
  • Stromal cell-derived growth factor SF20
  • stromal cell-derived growth factor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, TCS
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD

Publications for IL25 Antibody (NBP2-48750) (0)

There are no publications for IL25 Antibody (NBP2-48750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL25 Antibody (NBP2-48750) (0)

There are no reviews for IL25 Antibody (NBP2-48750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL25 Antibody (NBP2-48750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for IL25 Antibody (NBP2-48750)

Discover related pathways, diseases and genes to IL25 Antibody (NBP2-48750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL25 Antibody (NBP2-48750)

Discover more about diseases related to IL25 Antibody (NBP2-48750).

Pathways for IL25 Antibody (NBP2-48750)

View related products by pathway.

PTMs for IL25 Antibody (NBP2-48750)

Learn more about PTMs related to IL25 Antibody (NBP2-48750).

Research Areas for IL25 Antibody (NBP2-48750)

Find related products by research area.

Blogs on IL25

There are no specific blogs for IL25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IL25 Antibody and receive a gift card or discount.


Gene Symbol C19ORF10