IL25 Antibody

Images

 
Immunohistochemistry: IL25 Antibody [NBP2-48750] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL25 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSY
Specificity
Specificity of human IL25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C19ORF10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL25 Recombinant Protein Antigen (NBP2-48750PEP)

Reactivity Notes

Highest antigen sequence identity to the following ortholog: Rat ENSRNOG00000046883 (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL25 Antibody

  • C19orf10
  • chromosome 19 open reading frame 10
  • EUROIMAGE1875335
  • IL-25
  • IL25IL27w
  • IL27
  • IL-27
  • interleukin 25
  • interleukin 27 working designation
  • Interleukin-25
  • Ly6elg
  • MYDGF
  • R33729_1
  • SF20
  • SF20hypothetical protein LOC56005
  • Stromal cell-derived growth factor SF20
  • stromal cell-derived growth factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-27362
Species: Hu
Applications: WB, IHC, IHC-P, TCS
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-19015
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-16197
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1975
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD

Publications for IL25 Antibody (NBP2-48750) (0)

There are no publications for IL25 Antibody (NBP2-48750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL25 Antibody (NBP2-48750) (0)

There are no reviews for IL25 Antibody (NBP2-48750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL25 Antibody (NBP2-48750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for IL25 Antibody (NBP2-48750)

Discover related pathways, diseases and genes to IL25 Antibody (NBP2-48750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL25 Antibody (NBP2-48750)

Discover more about diseases related to IL25 Antibody (NBP2-48750).
 

Pathways for IL25 Antibody (NBP2-48750)

View related products by pathway.

PTMs for IL25 Antibody (NBP2-48750)

Learn more about PTMs related to IL25 Antibody (NBP2-48750).
 

Research Areas for IL25 Antibody (NBP2-48750)

Find related products by research area.

Blogs on IL25

There are no specific blogs for IL25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C19ORF10
Entrez