IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen

Images

 
There are currently no images for IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen (NBP3-21361PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-27R alpha/WSX-1/TCCR

Source: E.coli

Amino Acid Sequence: QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL27RA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21361. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen

  • class I cytokine receptor
  • CRL1IL-27R
  • Cytokine receptor-like 1
  • IL-27 R alpha
  • IL27R alpha
  • IL27R
  • IL27RA
  • IL-27Ra
  • IL-27R-alpha
  • interleukin 27 receptor, alpha
  • interleukin-27 receptor subunit alpha
  • TCCR
  • TCCRIL-27 receptor subunit alpha
  • T-cell cytokine receptor type 1
  • Type I T-cell cytokine receptor
  • WSX-1
  • WSX1IL-27R subunit alpha
  • zcytor1

Background

Upon antigen challenge, T-helper cells differentiate into two functionally distinct subsets, Th1 and Th2. Th1 cells produce IL-2, IFN-g and lymphotoxin-b that augment cell mediated immune response while Th2 cells secrete IL-4, IL-5, and IL-10 that enhance humoral immunity. The function of T-helper cells is regulated by cytokines. A novel cytokine receptor was recently identified and cloned. It is a new member in the type I cytokine receptor family and designated TCCR for T-cell cytokine receptor and WSX-1. TCCR deficient mice had impaired Th1 responses to protein antigen challenge, including decreased levels of IFN-g and Th1-dependent antibody IgG2a. TCCR is predominantly expressed in thymus, spleen, lymph notes and peripheral blood leukocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2274
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
2526-IL
Species: Hu
Applications: BA
DGP00
Species: Hu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
NBP1-83349
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
DY417
Species: Mu
Applications: ELISA
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-43299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
NBP2-27362
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, TCS, WB
DY421
Species: Mu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP3-21361PEP
Species: Hu
Applications: AC

Publications for IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen (NBP3-21361PEP) (0)

There are no publications for IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen (NBP3-21361PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen (NBP3-21361PEP) (0)

There are no reviews for IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen (NBP3-21361PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen (NBP3-21361PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-27R alpha/WSX-1/TCCR Products

Research Areas for IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen (NBP3-21361PEP)

Find related products by research area.

Blogs on IL-27R alpha/WSX-1/TCCR

There are no specific blogs for IL-27R alpha/WSX-1/TCCR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-27R alpha/WSX-1/TCCR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL27RA