IL-17RD/SEF Antibody

Images

 
Immunohistochemistry: IL-17 RD/SEF Antibody [NBP2-48711] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-17RD/SEF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LACKPFWKPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKRKTCKQEQTTETTSCLLQNVSPGDYIIELVDDTNTTRKVM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL17RD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL-17RD/SEF Recombinant Protein Antigen (NBP2-48711PEP)

Reactivity Notes

Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-17RD/SEF Antibody

  • FLJ35755
  • IL-17 RD
  • IL17RD
  • IL-17RD
  • IL-17RDIL-17 receptor D
  • IL17Rhom
  • IL17RLM
  • IL17RLMDKFZp434N1928
  • interleukin 17 receptor D
  • interleukin-17 receptor D
  • Interleukin-17 receptor-like protein
  • MGC133309
  • Sef homolog
  • SEF
  • SEFhSef

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
DY421
Species: Mu
Applications: ELISA
233-FB/CF
Species: Hu
Applications: BA
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB177
Species: Hu
Applications: CyTOF-ready, Flow, KO, Neut, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-87581
Species: Hu
Applications: IHC, IHC-P, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67358
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF2340
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
AF3749
Species: Hu
Applications: IHC, WB
NBP2-33278
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91148
Species: Hu
Applications: IHC, IHC-P
NB100-56740
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
H00006301-M01
Species: Hu, Mu, Ze
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-20262
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48711
Species: Hu
Applications: IHC, IHC-P

Publications for IL-17RD/SEF Antibody (NBP2-48711) (0)

There are no publications for IL-17RD/SEF Antibody (NBP2-48711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17RD/SEF Antibody (NBP2-48711) (0)

There are no reviews for IL-17RD/SEF Antibody (NBP2-48711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-17RD/SEF Antibody (NBP2-48711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-17RD/SEF Products

Bioinformatics Tool for IL-17RD/SEF Antibody (NBP2-48711)

Discover related pathways, diseases and genes to IL-17RD/SEF Antibody (NBP2-48711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17RD/SEF Antibody (NBP2-48711)

Discover more about diseases related to IL-17RD/SEF Antibody (NBP2-48711).
 

Pathways for IL-17RD/SEF Antibody (NBP2-48711)

View related products by pathway.

PTMs for IL-17RD/SEF Antibody (NBP2-48711)

Learn more about PTMs related to IL-17RD/SEF Antibody (NBP2-48711).

Blogs on IL-17RD/SEF

There are no specific blogs for IL-17RD/SEF, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-17RD/SEF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17RD