![Immunocytochemistry/Immunofluorescence: IL-17RD/SEF Antibody [NBP2-47420] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & the Golgi apparatus.](http://images.novusbio.com/fullsize/IL-17RD-SEF-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47420-img0003.jpg "Immunocytochemistry/Immunofluorescence: IL-17RD/SEF Antibody [NBP2-47420] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & the Golgi apparatus.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit IL-17RD/SEF Antibody - BSA Free (NBP2-47420) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NCSTYLNPVGKHVIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKD |
| Predicted Species | Mouse (96%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IL17RD |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IL17RD |
![Immunohistochemistry-Paraffin: IL-17RD/SEF Antibody [NBP2-47420] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/IL-17RD-SEF-Antibody-Immunohistochemistry-Paraffin-NBP2-47420-img0006.jpg "Immunohistochemistry-Paraffin: IL-17RD/SEF Antibody [NBP2-47420] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: IL-17RD/SEF Antibody [NBP2-47420] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/IL-17RD-SEF-Antibody-Immunohistochemistry-Paraffin-NBP2-47420-img0004.jpg "Immunohistochemistry-Paraffin: IL-17RD/SEF Antibody [NBP2-47420] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: IL-17RD/SEF Antibody [NBP2-47420] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/IL-17RD-SEF-Antibody-Immunohistochemistry-Paraffin-NBP2-47420-img0005.jpg "Immunohistochemistry-Paraffin: IL-17RD/SEF Antibody [NBP2-47420] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: IL-17RD/SEF Antibody [NBP2-47420] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells and Bergmann glia.](http://images.novusbio.com/fullsize/IL-17RD-SEF-Antibody-Immunohistochemistry-Paraffin-NBP2-47420-img0007.jpg "Immunohistochemistry-Paraffin: IL-17RD/SEF Antibody [NBP2-47420] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells and Bergmann glia.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A IL-17/IL-17A [Biotin]](https://images.novusbio.com/images2/DATA_IL17_DY421_ELISA_2448.jpg)
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![Neutralization IL-17RA/IL-17R Antibody (133617) [Unconjugated]](https://images.novusbio.com/images2/IL17_RA_MAB177_Block_Neutralize_15487.jpg)
![Flow Cytometry IL-17RA/IL-17R Antibody (133617) [Unconjugated]](https://images.novusbio.com/images2/IL17_RA_MAB177_CyTOFready_23136.jpg)
![Knockout Validated IL-17RA/IL-17R Antibody (133617) [Unconjugated]](https://images.novusbio.com/images2/IL17_RA_MAB177_Knockout_Validated_23137.jpg)
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")