IL-17RB Recombinant Protein Antigen

Images

 
There are currently no images for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-17RB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL17 RB.

Source: E. coli

Amino Acid Sequence: QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL17RB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85450.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-17RB Recombinant Protein Antigen

  • CRL4IL-17 receptor homolog 1
  • cytokine receptor CRL4
  • Cytokine receptor-like 4
  • Evi27
  • EVI27IL-17B receptor
  • IL-17 RB
  • IL-17 receptor B
  • IL-17 RH1
  • IL17BRinterleukin 17B receptor
  • IL-17ER
  • IL17RB
  • IL-17RB
  • IL17Rh1
  • IL-17Rh1
  • IL17RH1MGC5245
  • interleukin 17 receptor B
  • interleukin 17 receptor homolog 1
  • interleukin-17 receptor B
  • Interleukin-17B receptor

Background

IL17B Receptor is encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-40840
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
MAB177
Species: Hu
Applications: CyTOF-ready, Flow, KO, Neut, WB
DY421
Species: Mu
Applications: ELISA
AF8156
Species: Hu
Applications: ICC, IHC, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
6507-IL/CF
Species: Hu
Applications: BA
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
DY413
Species: Mu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-27203
Species: Ch, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: Flow, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-75465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-2567
Species: Hu
Applications: IHC,  IHC-P, IP, WB
DBLYS0B
Species: Hu
Applications: ELISA
NBP1-85450PEP
Species: Hu
Applications: AC

Publications for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP) (0)

There are no publications for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP) (0)

There are no reviews for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-17RB Products

Research Areas for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP)

Find related products by research area.

Blogs on IL-17RB

There are no specific blogs for IL-17RB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-17RB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17RB