IL-12 R beta 2 Antibody

Images

 
Immunohistochemistry: IL-12 R beta 2 Antibody [NBP1-85983] - Staining of human cerebral cortex shows strong positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-12 R beta 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL12RB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL-12 R beta 2 Protein (NBP1-85983PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-12 R beta 2 Antibody

  • IL-12 R beta 2
  • IL-12 receptor beta 2
  • IL-12 receptor subunit beta-2
  • IL12R beta 2
  • IL-12R subunit beta-2
  • IL12RB2
  • IL-12Rb2
  • IL-12R-beta-2
  • interleukin 12 receptor, beta 2
  • interleukin-12 receptor beta-2 chain
  • interleukin-12 receptor subunit beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF839
Species: Hu
Applications: WB
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF6696
Species: Hu, Mu, Rt
Applications: WB, ICC

Publications for IL-12 R beta 2 Antibody (NBP1-85983) (0)

There are no publications for IL-12 R beta 2 Antibody (NBP1-85983).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-12 R beta 2 Antibody (NBP1-85983) (0)

There are no reviews for IL-12 R beta 2 Antibody (NBP1-85983). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-12 R beta 2 Antibody (NBP1-85983) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-12 R beta 2 Products

Bioinformatics Tool for IL-12 R beta 2 Antibody (NBP1-85983)

Discover related pathways, diseases and genes to IL-12 R beta 2 Antibody (NBP1-85983). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-12 R beta 2 Antibody (NBP1-85983)

Discover more about diseases related to IL-12 R beta 2 Antibody (NBP1-85983).
 

Pathways for IL-12 R beta 2 Antibody (NBP1-85983)

View related products by pathway.

PTMs for IL-12 R beta 2 Antibody (NBP1-85983)

Learn more about PTMs related to IL-12 R beta 2 Antibody (NBP1-85983).
 

Research Areas for IL-12 R beta 2 Antibody (NBP1-85983)

Find related products by research area.

Blogs on IL-12 R beta 2

There are no specific blogs for IL-12 R beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-12 R beta 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL12RB2
Entrez
Uniprot