IL-11 Antibody (1F1) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
IL11 (NP_000632.1, 25 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDS |
| Specificity |
IL11 - interleukin 11 (1F1) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
IL11 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IL-11 Antibody (1F1)
Background
The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Publications for IL-11 Antibody (H00003589-M17) (0)
There are no publications for IL-11 Antibody (H00003589-M17).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-11 Antibody (H00003589-M17) (0)
There are no reviews for IL-11 Antibody (H00003589-M17).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-11 Antibody (H00003589-M17) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-11 Products
Research Areas for IL-11 Antibody (H00003589-M17)
Find related products by research area.
|
Blogs on IL-11