IL-10R alpha Recombinant Protein Antigen

Images

 
There are currently no images for IL-10R alpha Recombinant Protein Antigen (NBP3-21324PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-10R alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-10R alpha

Source: E.coli

Amino Acid Sequence: HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL10RA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21324. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-10R alpha Recombinant Protein Antigen

  • CD210 antigen
  • CDw210a
  • HIL-10R
  • IBD28
  • IL-10 R alpha
  • IL-10 receptor subunit alpha
  • IL10R alpha
  • IL-10R subunit 1
  • IL-10R1
  • IL10RA
  • IL-10Ra
  • IL10RIL-10R subunit alpha
  • interleukin 10 receptor, alpha
  • interleukin-10 receptor alpha chain
  • Interleukin-10 receptor subunit 1
  • interleukin-10 receptor subunit alpha

Background

The IL-10 receptor, IL-10R, is a member of the class II subgroup of the cytokine receptor family and exhibits structural similarity to the interferon receptor. IL-10R is expressed in B cells and T helper cells, as well as in LPS-induced mouse fibroblasts. Overall, mouse IL-10R and human IL-10R share 60% sequence identity at the protein level. Stimulation with IL-10 leads to tyrosine phosphorylation of JAK1 and Tyk2, but not JAK2 or JAK3. In addition to its role as an antagonist of IFN-gamma-mediated macrophage activation, IL-10Ralpha transmits differentiation as well as proliferative signals. IL-10R is constitutively expressed on human natural killer (NK) cells and the direct binding of IL-10 potentiates cytokine production by human NK cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY417
Species: Mu
Applications: ELISA
MAB874
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
782-IL
Species: Hu
Applications: BA
MAB5696
Species: Hu, Mu
Applications: WB
MAB15041
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
6507-IL/CF
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
201-LB
Species: Hu
Applications: BA
AF1709
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
1102-IL/CF
Species: Hu
Applications: BA
AF1375
Species: Hu
Applications: WB
DY1335B
Species: Hu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DRA00B
Species: Hu
Applications: ELISA
202-IL
Species: Hu
Applications: BA

Publications for IL-10R alpha Recombinant Protein Antigen (NBP3-21324PEP) (0)

There are no publications for IL-10R alpha Recombinant Protein Antigen (NBP3-21324PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-10R alpha Recombinant Protein Antigen (NBP3-21324PEP) (0)

There are no reviews for IL-10R alpha Recombinant Protein Antigen (NBP3-21324PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-10R alpha Recombinant Protein Antigen (NBP3-21324PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-10R alpha Products

Research Areas for IL-10R alpha Recombinant Protein Antigen (NBP3-21324PEP)

Find related products by research area.

Blogs on IL-10R alpha

There are no specific blogs for IL-10R alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-10R alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL10RA