IKK beta Antibody - BSA Free

Western Blot: IKK beta Antibody [NBP1-87699] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IKBKB antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: IKK beta Antibody [NBP1-87699] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: IKK beta Antibody [NBP1-87699] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IKK beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IKK beta Antibody - BSA Free (NBP1-87699) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-IKK beta Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IKBKB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IKK beta Protein (NBP1-87699PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%). Reactivity reported in scientific literature (PMID: 22093360).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IKK beta Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.10
• I-kappa-B kinase 2
• I-kappa-B-kinase beta
• IkBKB
• IKK beta
• IKK2
• IKK2FLJ38368
• IKK-B
• IKK-betaFLJ36218
• IKKBFLJ40509
• inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
• inhibitor of nuclear factor kappa-B kinase subunit beta
• MGC131801
• NFKBIKB
• NFKBIKBFLJ33771
• Nuclear factor NF-kappa-B inhibitor kinase beta

Background

NF-kB (nuclear factor kB) is sequestered in the cytoplasm by IkB family of inhibitory proteins that mask the nuclear localization signal of NF-kB thereby preventing translocation of NF-kB to the nucleus (1). External stimuli such as tumor necrosis factor or other cytokines results in phosphorylation and degradation of IkB releasing NF-kB dimers. NF-kB dimer subsequently translocates to the nucleus and activates target genes. Synthesis of IkBa is autoregulated (2). IkB proteins are phosphorylated by IkB kinase complex consisting of at least three proteins, IKK1/a, IKK2/b, and IKK3/g (3-5). IKK1/a and IKK2/b are phosphorylated by NF-kB-inducing kinase (NIK) (6) and MAP kinase kinase kinase-1 (MEKK1) (7), respectively. Recent studies have shown that IKK2/b, not IKK1/a, is the target proinflammatory stimuli (9). Targeted disruption of IKK2/b gene in mice also results in extensive liver damage from apotopsis and death as embryo (9).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IKK beta Antibody (NBP1-87699)(1)

Publication using NBP1-87699

• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

Bioinformatics

• Gene Symbol: IKBKB