![Immunohistochemistry: IGSF9 Antibody [NBP1-93676] - Expression of IGSF9 in normal endometrium and endometrial carcinoma. IHC staining of IGSF9, the right half is noncancerous endometrial glands with weak brown stain, while the left side cancer cells stained strongly brown indicating higher level of expression. Image collected and cropped by CiteAb from the following publication (//www.hindawi.com/journals/jo/2018/2439527/), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/IGSF9-Antibody-Immunohistochemistry-NBP1-93676-img0003.jpg "Immunohistochemistry: IGSF9 Antibody [NBP1-93676] - Expression of IGSF9 in normal endometrium and endometrial carcinoma. IHC staining of IGSF9, the right half is noncancerous endometrial glands with weak brown stain, while the left side cancer cells stained strongly brown indicating higher level of expression. Image collected and cropped by CiteAb from the following publication (//www.hindawi.com/journals/jo/2018/2439527/), licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit IGSF9 Antibody - BSA Free (NBP1-93676) is a polyclonal antibody validated for use in IHC. Anti-IGSF9 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVG |
| Predicted Species | Mouse (90%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IGSF9 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-93676 | Applications | Species |
|---|---|---|
| Shi Z, Li C, Tarwater L et al. RNA-seq Reveals the Overexpression of IGSF9 in Endometrial Cancer. J Oncol 2018-02-14 [PMID: 29666643] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IGSF9 |
![Immunohistochemistry-Paraffin: IGSF9 Antibody [NBP1-93676] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.](http://images.novusbio.com/fullsize/IGSF9-Antibody-Immunohistochemistry-Paraffin-NBP1-93676-img0002.jpg "Immunohistochemistry-Paraffin: IGSF9 Antibody [NBP1-93676] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.")
![Immunohistochemistry: IGSF9 Antibody [NBP1-93676] - Histopathological & immunohistochemical evaluation of endometrial carcinoma. (a) & (b) H&E stain of endometrioid endometrial carcinoma, histological grades I & II, respectively; (c) & (d) Ki67 stain on grade I & II sections, respectively; (e) & (f) IGSF9 stain on grade I & II sections, respectively. Both immunostains were quantified with the image analysis tools from Aperio digital pathology system. Numeric data were used in statistical analysis. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29666643), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-93676_rabbit-polyclonal-igsf9-antibody-310202415345321.jpg "Immunohistochemistry: IGSF9 Antibody [NBP1-93676] - Histopathological & immunohistochemical evaluation of endometrial carcinoma. (a) & (b) H&E stain of endometrioid endometrial carcinoma, histological grades I & II, respectively; (c) & (d) Ki67 stain on grade I & II sections, respectively; (e) & (f) IGSF9 stain on grade I & II sections, respectively. Both immunostains were quantified with the image analysis tools from Aperio digital pathology system. Numeric data were used in statistical analysis. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29666643), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CHL1_AF2147_Immunohistochemistry_17310.jpg)
![Simple Western CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CHL1_AF2147_Simple_Western_18656.jpg)
![Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2147_mouse-chl-1-l1cam-2-affinity-purified-polyclonal-ab-412024124025.jpg)
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-13112025131420.jpg)
![Immunohistochemistry CLC Antibody (138815) [Unconjugated]](https://images.novusbio.com/images2/CLC_MAB962_Immunohistochemistry_17289.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")