IGSF1 Recombinant Protein Antigen

Images

 
There are currently no images for IGSF1 Recombinant Protein Antigen (NBP2-68582PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IGSF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGSF1.

Source: E. coli

Amino Acid Sequence: SRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKVLELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICRTHIQM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IGSF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68582.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IGSF1 Recombinant Protein Antigen

  • CHTE
  • IGCD1
  • IGDC1
  • IGDC1Pituitary gland-specific factor 2
  • IGSF1
  • immunoglobulin superfamily member 1
  • immunoglobulin superfamily, member 1
  • Immunoglobulin-like domain-containing protein 1
  • InhBP
  • Inhibin-binding protein
  • KIAA0364p120
  • MGC75490
  • p120
  • PGSF2
  • PGSF2IGCD1

Background

IGSF1 is a gene that codes for a protein that works as a coreceptor in inhibin signaling and antagonizes activing A signaling and is necessary to control the effect of inhibin B during transcription, and is expressed highly in the pancreas, testis, and fetal liver, with a weaker expression in the heart, prostate, and small intestine. There are four isoforms of IGSF1, with lengths of 1336, 1327, 242, and 1341 amino acids and weights of approximately 149, 148, 27 and 149 kDa respectively. Current studies are being done on several disorders and diseases related to this gene including subacute sclerosing panencephalitis, Gaucher's disease, and prostatitis. IGSF1 has also been shown to have interactions with HECTD1, RANBP10, IGF1, ACVR1, and ACVR1B in pathways such as the signal transduction of Activin A pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
236-EG
Species: Hu
Applications: BA
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86588
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DRT100
Species: Hu
Applications: ELISA
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1002
Species: Mu
Applications: Dual ISH-IHC, IHC, Simple Western, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-68582PEP
Species: Hu
Applications: AC

Publications for IGSF1 Recombinant Protein Antigen (NBP2-68582PEP) (0)

There are no publications for IGSF1 Recombinant Protein Antigen (NBP2-68582PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF1 Recombinant Protein Antigen (NBP2-68582PEP) (0)

There are no reviews for IGSF1 Recombinant Protein Antigen (NBP2-68582PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IGSF1 Recombinant Protein Antigen (NBP2-68582PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGSF1 Products

Array NBP2-68582PEP

Blogs on IGSF1

There are no specific blogs for IGSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IGSF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IGSF1