IGHMBP2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IGHMBP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IGHMBP2 Antibody - BSA Free
Background
The IGHMBP2 gene encodes a helicase superfamily member that binds a specific DNA sequence from the immunoglobulin mu chain switch region. Mutations in this gene lead to spinal muscle atrophy with respiratory distress type 1. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for IGHMBP2 Antibody (NBP2-57526) (0)
There are no publications for IGHMBP2 Antibody (NBP2-57526).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGHMBP2 Antibody (NBP2-57526) (0)
There are no reviews for IGHMBP2 Antibody (NBP2-57526).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IGHMBP2 Antibody (NBP2-57526) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IGHMBP2 Products
Research Areas for IGHMBP2 Antibody (NBP2-57526)
Find related products by research area.
|
Blogs on IGHMBP2