IGHMBP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IGHMBP2 Antibody [NBP2-57526] - Staining of human cell line CACO-2 shows localization to nucleus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IGHMBP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGHMBP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IGHMBP2 Recombinant Protein Antigen (NBP2-57526PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IGHMBP2 Antibody - BSA Free

• ATP-dependent helicase IGHMBP2
• CATF1FLJ41171
• EC 3.6.1
• EC 3.6.4.12
• EC 3.6.4.13
• GF-1
• Glial factor 1
• HCSA
• HMN6cardiac transcription factor 1
• immunoglobulin mu binding protein 2
• Immunoglobulin mu-binding protein 2
• SMARD1DNA-binding protein SMUBP-2
• SMBP2
• SMUBP2FLJ34220

Background

The IGHMBP2 gene encodes a helicase superfamily member that binds a specific DNA sequence from the immunoglobulin mu chain switch region. Mutations in this gene lead to spinal muscle atrophy with respiratory distress type 1. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGHMBP2