IGHG1 Antibody

Images

 
Western Blot: IGHG1 Antibody [H00003500-D01P] - Analysis of IGHG1 expression in transfected 293T cell line by IGHG1 polyclonal antibody.Lane 1: IGHG1 transfected lysate(51.30 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: IGHG1 Antibody [H00003500-D01P] - Analysis of antibody to IGHG1 on HeLa cell. Antibody concentration 30 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGHG1 Antibody Summary

Immunogen
IGHG1 (AAH92518.1, 1 a.a. - 469 a.a.) full-length human protein. MEFGLSWVFLVAILKGVQCEVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCATRGGYSTAGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Specificity
Reacts with immunoglobulin heavy constant gamma 1 (G1m marker).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGHG1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IGHG1 Antibody

  • immunoglobulin heavy constant gamma 1 (G1m marker)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDXCH02P-100
Species: Hu
Applications: IHC-Fr, IHC-P, Flow-CS, Flow-IC, IF
NBP1-74190
Species: Mu
Applications: WB, ChIP
DDXCH04A488-100
Species: Hu
Applications: Flow-CS, Flow-IC, IF
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003494-B01P
Species: Hu
Applications: WB, ICC/IF
AF4409
Species: Mu
Applications: WB
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF8537
Species: Mu, Rt
Applications: WB, Simple Western, ICC
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC

Publications for IGHG1 Antibody (H00003500-D01P) (0)

There are no publications for IGHG1 Antibody (H00003500-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGHG1 Antibody (H00003500-D01P) (0)

There are no reviews for IGHG1 Antibody (H00003500-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IGHG1 Antibody (H00003500-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGHG1 Products

Bioinformatics Tool for IGHG1 Antibody (H00003500-D01P)

Discover related pathways, diseases and genes to IGHG1 Antibody (H00003500-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGHG1 Antibody (H00003500-D01P)

Discover more about diseases related to IGHG1 Antibody (H00003500-D01P).
 

Pathways for IGHG1 Antibody (H00003500-D01P)

View related products by pathway.

PTMs for IGHG1 Antibody (H00003500-D01P)

Learn more about PTMs related to IGHG1 Antibody (H00003500-D01P).
 

Research Areas for IGHG1 Antibody (H00003500-D01P)

Find related products by research area.

Blogs on IGHG1

There are no specific blogs for IGHG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGHG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGHG1
Entrez