Recombinant Human IGDCC3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human IGDCC3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 37-136 of Human IGDCC3

Source: Wheat Germ

Amino Acid Sequence: GHSAELAFAVEPSDDVAVPGQPIVLDCRVEGTPPVRITWRKNGVELPESTHSTLLANGSLMIRHFRLEPGGSPSDEGDYECVAQNRFGLVVSRKARIQAA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
IGDCC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IGDCC3 Protein

  • HsT18880
  • IGDCC3
  • immunoglobulin superfamily DCC subclass member 3
  • immunoglobulin superfamily, DCC subclass, member 3
  • PUNC
  • Putative neuronal cell adhesion moleculePUNCHsT18880

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92195
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
AF4919
Species: Mu
Applications: WB, IHC
AF844
Species: Mu
Applications: WB, Block
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NB100-77903
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NBP1-78278
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP2-29464
Species: Hu, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC, IF

Publications for IGDCC3 Partial Recombinant Protein (H00009543-Q01) (0)

There are no publications for IGDCC3 Partial Recombinant Protein (H00009543-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGDCC3 Partial Recombinant Protein (H00009543-Q01) (0)

There are no reviews for IGDCC3 Partial Recombinant Protein (H00009543-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGDCC3 Partial Recombinant Protein (H00009543-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array H00009543-Q01

Bioinformatics Tool for IGDCC3 Partial Recombinant Protein (H00009543-Q01)

Discover related pathways, diseases and genes to IGDCC3 Partial Recombinant Protein (H00009543-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on IGDCC3

There are no specific blogs for IGDCC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IGDCC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IGDCC3