IFN-kappa Antibody - Azide and BSA Free Summary
| Immunogen |
IFN-kappa(Q9P0W0, 1 a.a. ~ 207 a.a) full-length human protein. MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDENENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IFNK |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IFN-kappa Antibody - Azide and BSA Free
Background
IFN-kappa (Interferon kappa) is a secreted, nonglycosylated polypeptide that belongs to the IFN-kappa subclass of the type I interferon family of cytokines. It is expressed by macrophages in mice, and monocytes, dendritic cells and keratinocytes in human. IFN-kappa induces TNF-alpha, IL-10 and MCP-1 production by monocytes. Mouse IFN-kappa precursor is 199 amino acids (aa) in length. It contains a 21 aa signal sequence, plus a 178 aa mature region. There are two intrachain disulfide bonds plus a fifth unpaired cysteine. Mature mouse IFN-kappa (aa 22-199) shares 68% and 30% aa identity with rat and human IFN-kappa, respectively.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Mu
Applications: ELISA
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for IFN-kappa Antibody (H00056832-D01P) (0)
There are no publications for IFN-kappa Antibody (H00056832-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFN-kappa Antibody (H00056832-D01P) (0)
There are no reviews for IFN-kappa Antibody (H00056832-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IFN-kappa Antibody (H00056832-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IFN-kappa Products
Research Areas for IFN-kappa Antibody (H00056832-D01P)
Find related products by research area.
|
Blogs on IFN-kappa