IFN-epsilon Antibody (3B8)

Images

 
Western Blot: IFNE1 Antibody (3B8) [H00338376-M01] - IFNE1 monoclonal antibody (M01), clone 3B8. Analysis of IFNE expression in human spleen.
Immunoprecipitation: IFNE1 Antibody (3B8) [H00338376-M01] - Immunoprecipitation of IFNE transfected lysate using anti-IFNE monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IFNE MaxPab ...read more
Sandwich ELISA: IFNE1 Antibody (3B8) [H00338376-M01] - Detection limit for recombinant GST tagged IFNE1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, S-ELISA
Clone
3B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFN-epsilon Antibody (3B8) Summary

Immunogen
IFNE1 (NP_795372, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IFNE
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:2000
  • ELISA 1:100 - 1:2000
  • Immunoprecipitation 1:10 - 1:500
  • Sandwich ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFN-epsilon Antibody (3B8)

  • IFNE
  • IFN-E
  • IFNE1PRO655
  • IFNepsilon
  • IFN-epsilon
  • IFNT1
  • Ifn-tau-11
  • INFE1
  • interferon epsilon 1
  • interferon epsilon
  • Interferon epsilon-1
  • interferon tau-1
  • interferon, epsilon
  • interferon-epsilon
  • MGC119018
  • MGC119020

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5206
Species: Mu
Applications: WB, Simple Western
NBP1-32905
Species: Hu, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-25236
Species: Hu
Applications: WB, IHC, IHC-P
MAB197
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, KO
NBP1-88142
Species: Hu
Applications: IHC, IHC-P
NBP1-49045
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Po, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00338376-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA

Publications for IFN-epsilon Antibody (H00338376-M01) (0)

There are no publications for IFN-epsilon Antibody (H00338376-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-epsilon Antibody (H00338376-M01) (0)

There are no reviews for IFN-epsilon Antibody (H00338376-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFN-epsilon Antibody (H00338376-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IFN-epsilon Products

Bioinformatics Tool for IFN-epsilon Antibody (H00338376-M01)

Discover related pathways, diseases and genes to IFN-epsilon Antibody (H00338376-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-epsilon Antibody (H00338376-M01)

Discover more about diseases related to IFN-epsilon Antibody (H00338376-M01).
 

Pathways for IFN-epsilon Antibody (H00338376-M01)

View related products by pathway.

Blogs on IFN-epsilon

There are no specific blogs for IFN-epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-epsilon Antibody (3B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNE