IFN-alpha/beta R1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IFN-alpha/beta R1 Antibody [NBP1-83119] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody [NBP1-83119] - Staining of human appendix shows cytoplasmic positivity in leukocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFN-alpha/beta R1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFNAR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFN-alpha/beta R1 Protein (NBP1-83119PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFN-alpha/beta R1 Antibody

  • alpha-type antiviral protein
  • AVP
  • beta-type antiviral protein
  • CRF2-1
  • Cytokine receptor class-II member 1
  • Cytokine receptor family 2 member 1
  • human interferon-alpha receptor (HuIFN-alpha-Rec)10IFRC
  • IFN-alpha/beta R1
  • IFN-alpha/beta receptor 1
  • IFN-alpha-REC
  • IFNAR
  • IFNAR1
  • IFN-aR1
  • IFNBR
  • IFNbR1
  • IFN-bR1
  • IFN-R-1
  • interferon (alpha, beta and omega) receptor 1
  • interferon alpha/beta receptor 1
  • interferon-alpha/beta receptor alpha chain
  • interferon-beta receptor 1
  • Type I interferon receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00028299-P01
Species: Hu
7570-GH
Species: Hu
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS272
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for IFN-alpha/beta R1 Antibody (NBP1-83119) (0)

There are no publications for IFN-alpha/beta R1 Antibody (NBP1-83119).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFN-alpha/beta R1 Antibody (NBP1-83119) (0)

There are no reviews for IFN-alpha/beta R1 Antibody (NBP1-83119). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IFN-alpha/beta R1 Antibody (NBP1-83119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFN-alpha/beta R1 Products

Bioinformatics Tool for IFN-alpha/beta R1 Antibody (NBP1-83119)

Discover related pathways, diseases and genes to IFN-alpha/beta R1 Antibody (NBP1-83119). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFN-alpha/beta R1 Antibody (NBP1-83119)

Discover more about diseases related to IFN-alpha/beta R1 Antibody (NBP1-83119).
 

Pathways for IFN-alpha/beta R1 Antibody (NBP1-83119)

View related products by pathway.

PTMs for IFN-alpha/beta R1 Antibody (NBP1-83119)

Learn more about PTMs related to IFN-alpha/beta R1 Antibody (NBP1-83119).
 

Research Areas for IFN-alpha/beta R1 Antibody (NBP1-83119)

Find related products by research area.

Blogs on IFN-alpha/beta R1

There are no specific blogs for IFN-alpha/beta R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFN-alpha/beta R1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNAR1
Entrez