IFN-alpha 4 Antibody - BSA Free

Western Blot: IFN-alpha 4 Antibody [NBP2-86673] - WB Suggested Anti-IFNA4 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Stomach

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IFN-alpha 4 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFN-alpha 4. Peptide sequence: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFNA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IFN-alpha 4 Antibody - BSA Free

• IFNA4
• IFNalpha 4
• IFN-alpha 4
• IFN-alpha-4
• IFN-alpha4a
• INFA4
• interferon alpha-4
• Interferon alpha-4B
• Interferon alpha-76
• Interferon alpha-M1
• interferon, alpha 4
• MGC142200

Background

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFNA4