IFIT5 Antibody - BSA Free

Western Blot: IFIT5 Antibody [NBP2-56869] - Western blot analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: IFIT5 Antibody [NBP2-56869] - Staining of human cell line A-431 shows localization to plasma membrane & vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IFIT5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: THNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDIFRKALRLENITDDHKHQIHYH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFIT5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IFIT5 Recombinant Protein Antigen (NBP2-56869PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IFIT5 Antibody - BSA Free

• FLJ53857
• IFIT-5
• interferon-induced protein with tetratricopeptide repeats 5
• Retinoic acid- and interferon-inducible 58 kDa protein
• retinoic acid- and interferon-inducible protein (58kD)
• RI58FLJ92678

Background

IFIT5( AAH25786, 1 a.a. - 483 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFIT5