IFI35 Antibody - BSA Free

Western Blot: IFI35 Antibody [NBP3-17724] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

Immunohistochemistry-Paraffin: IFI35 Antibody [NBP3-17724] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IFI35 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IFI35 Antibody - BSA Free (NBP3-17724) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFI35
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IFI35 Antibody - BSA Free

• FLJ21753
• ifi-35
• IFP 35
• IFP35interferon-induced 35 kDa protein
• interferon-induced protein 35

Background

IFI35, also known as Interferon-induced 35 kDa protein, consists of 2 isoforms, a 286 amino acid isoform 1 that is 31.5 kDa and a 188 amino acid isoform that is 32 kDa, has nucleus subcellular location and can be found in a wide range of cell types, including fibroblasts, macrophages, and epithelial cells. Its function is not yet known. Studies of this protein are being performed on research about diverticulitis and ovarian cancer. This protein plays a role in interferon alpha/beta signaling, cytokine signaling in immune system, expression of IFN-induced genes, interferon signaling, and immune system pathways where it interacts with CLEC4G, BATF, PLEKHO1, NMI, and MAPK1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFI35