BATF Antibody (8A12) - Azide and BSA Free

Western Blot: BATF Antibody (8A12) [H00010538-M01] - BATF monoclonal antibody (M01), clone 8A12. Analysis of BATF expression in NIH/3T3.

Western Blot: BATF Antibody (8A12) [H00010538-M01] - BATF monoclonal antibody (M01), clone 8A12. Analysis of BATF expression in PC-12.

Western Blot: BATF Antibody (8A12) [H00010538-M01] - BATF monoclonal antibody (M01), clone 8A12 Analysis of BATF expression in Hela S3 NE.

Western Blot: BATF Antibody (8A12) [H00010538-M01] - BATF monoclonal antibody (M01), clone 8A12. Analysis of BATF expression in Raw 264.7.

Western Blot: BATF Antibody (8A12) [H00010538-M01] - Analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M01), clone 8A12.Lane 1: BATF transfected lysate(14.1 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: BATF Antibody (8A12) [H00010538-M01] - Analysis of BATF transfected lysate using anti-BATF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BATF MaxPab rabbit polyclonal antibody.

ELISA: BATF Antibody (8A12) [H00010538-M01] - Detection limit for recombinant GST tagged BATF is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP, ChIP
• Clone: 8A12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BATF Antibody (8A12) - Azide and BSA Free Summary

• Immunogen: BATF (NP_006390, 34 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
• Specificity: BATF - basic leucine zipper transcription factor, ATF-like
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: BATF
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP)
  • ELISA
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BATF Antibody (8A12) - Azide and BSA Free

• basic leucine zipper transcription factor, ATF-like
• BATF
• BATF1basic leucine zipper transcriptional factor ATF-like
• B-ATFSFA2
• B-cell-activating transcription factor
• SFA2
• SFA-2activating transcription factor B
• SF-HT-activated gene 2 protein

Background

The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BATF Antibody (H00010538-M01)(1)

Publication using H00010538-M01

• Kuroda S, Yamazaki M, Abe M et al. Basic leucine zipper transcription factor, ATF-like (BATF) regulates epigenetically and energetically effector CD8 T-cell differentiation via Sirt1 expression. Proc Natl Acad Sci U S A. 2011-08-22 [PMID: 21873234]

Bioinformatics

• Gene Symbol: BATF
• Entrez:
  • 10538(Human)
• Uniprot:
  • NP_006390(Human)