![Western Blot: IFI35 Antibody [H00003430-D01P] - Analysis of IFI35 expression in A-431.](http://images.novusbio.com/fullsize/IFI35-Antibody-Western-Blot-H00003430-D01P-img0005.jpg "Western Blot: IFI35 Antibody [H00003430-D01P] - Analysis of IFI35 expression in A-431.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | IFI35 (NP_005524.1, 1 a.a. - 288 a.a.) full-length human protein. MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG |
| Specificity | IFI35 - interferon-induced protein 35, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IFI35 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00003430-D01P | Applications | Species |
|---|---|---|
| Xiating M, Danning W, Na X et al. The danger signal interferon-induced protein 35 (IFP35) mediates acetaminophen-induced liver injury Biochem Biophys Res Commun. 2022-07-02 [PMID: 35809344] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IFI35 |
| Entrez |
|
| Uniprot |
|
![Chromatin Immunoprecipitation: IFI35 Antibody [H00003430-D01P] - Analysis of antibody to IFI35 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/IFI35-Antibody-Chromatin-Immunoprecipitation-H00003430-D01P-img0007.jpg "Chromatin Immunoprecipitation: IFI35 Antibody [H00003430-D01P] - Analysis of antibody to IFI35 on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: IFI35 Antibody [H00003430-D01P] - Analysis of IFI35 expression in Raw 264.7.](http://images.novusbio.com/fullsize/IFI35-Antibody-Western-Blot-H00003430-D01P-img0004.jpg "Western Blot: IFI35 Antibody [H00003430-D01P] - Analysis of IFI35 expression in Raw 264.7.")
![Western Blot: IFI35 Antibody [H00003430-D01P] - Analysis of IFI35 expression in transfected 293T cell line by IFI35 polyclonal antibody.Lane 1: IFI35 transfected lysate(31.70 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/IFI35-Antibody-Western-Blot-H00003430-D01P-img0006.jpg "Western Blot: IFI35 Antibody [H00003430-D01P] - Analysis of IFI35 expression in transfected 293T cell line by IFI35 polyclonal antibody.Lane 1: IFI35 transfected lysate(31.70 KDa).Lane 2: Non-transfected lysate.")
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Immunohistochemistry Nidogen-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Nidogen2_AF3385_Immunohistochemistry_21102.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")