IER3IP1 Antibody


Western Blot: IER3IP1 Antibody [NBP1-90884] - Lane 1: Marker [kDa] 250, 150, 100, 75, 50, 37, 25, 20, 15, 10, 5, 2Lane 2: Human cell line HL-60
Immunocytochemistry/ Immunofluorescence: IER3IP1 Antibody [NBP1-90884] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IER3IP1 Antibody [NBP1-90884] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

IER3IP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT
Specificity of human IER3IP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IER3IP1 Protein (NBP1-90884PEP)
Read Publication using NBP1-90884.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IER3IP1 Antibody

  • immediate early response 3 interacting protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu
Applications: WB, IP, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, Neut
Species: Hu
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IER3IP1 Antibody (NBP1-90884)(1)

Reviews for IER3IP1 Antibody (NBP1-90884) (0)

There are no reviews for IER3IP1 Antibody (NBP1-90884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IER3IP1 Antibody (NBP1-90884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for IER3IP1 Antibody (NBP1-90884)

Discover related pathways, diseases and genes to IER3IP1 Antibody (NBP1-90884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IER3IP1 Antibody (NBP1-90884)

Discover more about diseases related to IER3IP1 Antibody (NBP1-90884).

Pathways for IER3IP1 Antibody (NBP1-90884)

View related products by pathway.

Blogs on IER3IP1

There are no specific blogs for IER3IP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IER3IP1 Antibody and receive a gift card or discount.


Gene Symbol IER3IP1