IDI1 Antibody (6G10)

Images

 
Western Blot: IDI1 Antibody (6G10) [H00003422-M01] - IDI1 monoclonal antibody (M01), clone 6G10 Analysis of IDI1 expression in HeLa.
Western Blot: IDI1 Antibody (6G10) [H00003422-M01] - Analysis of IDI1 expression in transfected 293T cell line by IDI1 monoclonal antibody (M01), clone 6G10.Lane 1: IDI1 transfected lysate(26.5 KDa).Lane 2: ...read more
Sandwich ELISA: IDI1 Antibody (6G10) [H00003422-M01] - Detection limit for recombinant GST tagged IDI1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IDI1 Antibody (6G10) Summary

Immunogen
IDI1 (NP_004499 175 a.a. - 283 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYR
Localization
Peroxisome
Specificity
IDI1 - isopentenyl-diphosphate delta isomerase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IDI1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IDI1 Antibody (6G10)

  • EC 5.3.3.2
  • IPP isomerase 1
  • IPP1
  • IPPI1
  • isopentenyl diphosphate dimethylallyl diphosphate isomerase 1
  • Isopentenyl pyrophosphate isomerase 1
  • isopentenyl-diphosphate delta isomerase 1
  • isopentenyl-diphosphate delta isomerase
  • isopentenyl-diphosphate Delta-isomerase 1

Background

IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16463
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00091734-M01
Species: Hu
Applications: WB, ELISA
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-93337
Species: Hu, Mu
Applications: WB, IP
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85949
Species: Hu, Po
Applications: WB, IHC, IHC-P
NBP2-50216
Species: Hu
Applications: WB, ELISA, IHC
NBP2-31364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16861
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-83306
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IDI1 Antibody (H00003422-M01) (0)

There are no publications for IDI1 Antibody (H00003422-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IDI1 Antibody (H00003422-M01) (0)

There are no reviews for IDI1 Antibody (H00003422-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IDI1 Antibody (H00003422-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for IDI1 Antibody (H00003422-M01)

Discover related pathways, diseases and genes to IDI1 Antibody (H00003422-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IDI1 Antibody (H00003422-M01)

Discover more about diseases related to IDI1 Antibody (H00003422-M01).
 

Pathways for IDI1 Antibody (H00003422-M01)

View related products by pathway.

PTMs for IDI1 Antibody (H00003422-M01)

Learn more about PTMs related to IDI1 Antibody (H00003422-M01).

Blogs on IDI1

There are no specific blogs for IDI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IDI1 Antibody (6G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol IDI1
Entrez
OMIM
Uniprot