ID2 Recombinant Protein Antigen

Images

 
There are currently no images for ID2 Protein (NBP1-88630PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ID2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ID2.

Source: E. coli

Amino Acid Sequence: MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ID2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88630.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ID2 Recombinant Protein Antigen

  • BHLHB26
  • bHLHb26cell growth-inhibiting gene 8
  • Class B basic helix-loop-helix protein 26
  • DNA-binding protein inhibitor ID2
  • DNA-binding protein inhibitor ID-2
  • GIG8
  • helix-loop-helix protein ID2
  • ID2
  • ID2A
  • ID2H
  • inhibitor of differentiation 2
  • Inhibitor of DNA binding 2
  • inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
  • MGC26389

Background

ID2 is encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP2-02136
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB7650
Species: Mu
Applications: IHC, WB
H00003400-B01P
Species: Hu, Mu
Applications: ICC/IF, WB
AF6116
Species: Hu
Applications: ICC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
314-BP
Species: Hu
Applications: BA, BA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF4196
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
355-BM
Species: Hu, Mu, Rt
Applications: BA
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-88630PEP
Species: Hu
Applications: AC

Publications for ID2 Protein (NBP1-88630PEP) (0)

There are no publications for ID2 Protein (NBP1-88630PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ID2 Protein (NBP1-88630PEP) (0)

There are no reviews for ID2 Protein (NBP1-88630PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ID2 Protein (NBP1-88630PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ID2 Products

Array NBP1-88630PEP

Research Areas for ID2 Protein (NBP1-88630PEP)

Find related products by research area.

Blogs on ID2

There are no specific blogs for ID2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ID2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ID2