ID1 Antibody (3F3)

Images

 
Immunocytochemistry/ Immunofluorescence: ID1 Antibody (3F3) [H00003397-M14] - Analysis of monoclonal antibody to ID1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: ID1 Antibody (3F3) [H00003397-M14] - Detection limit for recombinant GST tagged ID1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ID1 Antibody (3F3) Summary

Immunogen
ID1 (NP_002156, 47 a.a. - 155 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR*
Specificity
ID1 (3F3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ID1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ID1 Antibody (3F3)

  • BHLHB24
  • bHLHb24DNA-binding protein inhibitor ID-1
  • Class B basic helix-loop-helix protein 24
  • dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helixprotein)
  • dJ857M17.1.2
  • ID
  • ID1
  • inhibitor of differentiation 1
  • Inhibitor of DNA binding 1
  • inhibitor of DNA binding 1, dominant negative helix-loop-helix protein

Background

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
AF6116
Species: Hu
Applications: WB, ICC
355-BM/CF
Species: Hu, Mu, Rt
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00003397-M14
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ID1 Antibody (H00003397-M14) (0)

There are no publications for ID1 Antibody (H00003397-M14).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ID1 Antibody (H00003397-M14) (0)

There are no reviews for ID1 Antibody (H00003397-M14). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ID1 Antibody (H00003397-M14) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ID1 Products

Bioinformatics Tool for ID1 Antibody (H00003397-M14)

Discover related pathways, diseases and genes to ID1 Antibody (H00003397-M14). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ID1 Antibody (H00003397-M14)

Discover more about diseases related to ID1 Antibody (H00003397-M14).
 

Pathways for ID1 Antibody (H00003397-M14)

View related products by pathway.

PTMs for ID1 Antibody (H00003397-M14)

Learn more about PTMs related to ID1 Antibody (H00003397-M14).
 

Research Areas for ID1 Antibody (H00003397-M14)

Find related products by research area.

Blogs on ID1

There are no specific blogs for ID1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ID1 Antibody (3F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ID1
Entrez
OMIM
Uniprot