ICAT/CTNNBIP1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICAT/CTNNBIP1. Source: E. coli Amino Acid Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CTNNBIP1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59020. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for ICAT/CTNNBIP1 Recombinant Protein Antigen
Background
CTNNBIP1, or Beta-catenin-interacting protein 1, consists of a short 81 amino acid isoform that is approximately 9 kDa, and is involved in the negative regulation of the Wnt signaling pathway, and it also prevents CTNNB1 and TCF from interacting. Current research is being conducted on CTNNBIP1 and a number of diseases to determine the relationship between the two. Some of these disorders and diseases include: actinic cheilitis, nasopharyngitis, adenomatous polyposis coli, gastric cancer, cheilitis, esophagitis, esophageal squamous cell carcinoma, laryngitis, desmoid tumor, hepatocellular carcinoma, acute lymphoblastic leukemia, medulloblastoma, malignant glioma, duodenitis, wilms tumor, endometrial carcinoma, and polyposis. CTNNBIP1 is linked to the Wnt signaling pathway, where it interacts with JUP, CTNNB1, BEND5, CASP4, and CPVL.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: AC
Publications for ICAT/CTNNBIP1 Recombinant Protein Antigen (NBP2-59020PEP) (0)
There are no publications for ICAT/CTNNBIP1 Recombinant Protein Antigen (NBP2-59020PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ICAT/CTNNBIP1 Recombinant Protein Antigen (NBP2-59020PEP) (0)
There are no reviews for ICAT/CTNNBIP1 Recombinant Protein Antigen (NBP2-59020PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for ICAT/CTNNBIP1 Recombinant Protein Antigen (NBP2-59020PEP) (0)
Additional ICAT/CTNNBIP1 Products
Research Areas for ICAT/CTNNBIP1 Recombinant Protein Antigen (NBP2-59020PEP)
Find related products by research area.
|
Blogs on ICAT/CTNNBIP1