ICAM-4 Antibody - Azide and BSA Free

Western Blot: ICAM-4 Antibody [H00003386-B01P] - Analysis of ICAM4 expression in transfected 293T cell line by ICAM4 polyclonal antibody. Lane 1: ICAM4 transfected lysate(29.92 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB, Flow, Func
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ICAM-4 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ICAM4 (NP_001034221.1, 1 a.a. - 272 a.a.) full-length human protein. MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG
• Specificity: ICAM4 - intercellular adhesion molecule 4 (LW blood group),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ICAM4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Functional
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ICAM-4 Antibody - Azide and BSA Free

• CD242 antigen
• CD242
• ICAM4
• ICAM-4
• intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
• intercellular adhesion molecule 4 (LW blood group)
• intercellular adhesion molecule 4
• intercellular adhesion molecule 4, Landsteiner-Wiener blood group
• Landsteiner-Wiener blood group antigen a
• Landsteiner-Wiener blood group glycoprotein
• Landsteiner-Wiener blood group
• LWLW blood group protein

Background

This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ICAM-4 Antibody (H00003386-B01P)(2)

Publications using H00003386-B01P

• de Back DZ, Nezjad SG, Beuger BM et al. Apheresis causes complement deposition on red blood cells (RBCs) and RBC antigen alterations, possibly inducing enhanced clearance. Transfusion 2018-09-28 [PMID: 30265755]
• Zhu H, Zennadi R, Xu BX et al. Impaired adenosine-5'-triphosphate release from red blood cells promotes their adhesion to endothelial cells: a mechanism of hypoxemia after transfusion. Crit Care Med. 2011-11-01 [PMID: 21765360]

Bioinformatics

• Gene Symbol: ICAM4
• Entrez:
  • 3386(Human)
• Uniprot:
  • NP_001034221.1(Human)